KEGG   Rattus norvegicus (rat): 298318
Entry
298318            CDS       T01003                                 

Gene name
Slc25a43, RGD1559928
Definition
(RefSeq) solute carrier family 25, member 43
  KO
K15120  solute carrier family 25, member 43
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    298318 (Slc25a43)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   298318 (Slc25a43)
SSDB
Motif
Pfam: Mito_carr SLC25_like
Other DBs
NCBI-GeneID: 298318
NCBI-ProteinID: XP_003752180
RGD: 1559928
Ensembl: ENSRNOG00000012756
UniProt: D3ZG94
Position
Xq35
AA seq 329 aa
MATWRRDGRLTGSQRFLCAGLAGAFSLSLTAPLELATVLAQVGRVQSHSQGLWATGRRVW
LSEGPRALWKGNGVACLRLFPCSVVQLAAYRKFVVLFMDDLGRISQWSSIVAGSLAGMVS
TIVTYPTDLIKTRLIVQNMLEPSYRGLIHALSTIYQQEGFLALYRGASLTVLGAVPFSAG
SLLVYMNLEKIWTGPRDRFSHLQNFATVCVAAAVSQAVSFPFDTVKRKMQAQSPYLPHYG
GVDIHFSGAVDCFRQIVKTQGVLGLWNGLTANLLKVVPYFGVMFGMFEFCKRIFLYQNGY
TLSPLTYKLTPGVDQSLKPQELRELKKLF
NT seq 990 nt   +upstreamnt  +downstreamnt
atggctacgtggaggcgggatggccggctaaccggcagccagaggttcctgtgtgcgggg
ctggcgggggcgttcagccttagtctcaccgcgcccctggagctcgccactgtgctggcc
caagtcggcagggtgcaaagccactcccagggactgtgggccaccggacgccgtgtgtgg
ctgtccgaagggccaagagccctgtggaaagggaatggcgtggcgtgcctgcgcctcttc
ccctgcagtgtggtgcagctggctgcctaccgaaagtttgttgtgttattcatggatgac
ctgggccgtatttcccagtggagctccattgtggctggaagtctcgcaggcatggtttcc
acgattgtcacataccctacagacctcatcaaaacccgattgattgtgcagaacatgctg
gaaccatcttacagggggcttattcatgctctttctactatttatcaacaagaagggttc
ctggctctttatcgaggggcatccctcactgttttaggtgctgttcccttctcggctggc
tctcttctagtttacatgaacctggaaaaaatctggactggaccccgggaccgcttttct
cacctgcagaactttgccaccgtctgtgtggctgctgctgtgagccaggctgtctcattt
ccctttgacactgtgaagagaaagatgcaggctcaaagcccttatcttccccactatgga
ggagtagatatccacttctcaggagcagttgactgcttcagacagatagtgaagacccaa
ggggtcctggggctctggaacggactaacggctaacttactaaaggtagttccatatttt
ggagttatgtttggcatgtttgagttctgtaagagaatctttctttatcaaaatggttac
accctgtcccccctgacctacaaactaaccccaggagtggaccaaagtttgaagccccaa
gagttacgggaattaaagaagttattctaa

DBGET integrated database retrieval system