KEGG   Rattus norvegicus (rat): 298429
Entry
298429            CDS       T01003                                 

Gene name
Rad54l
Definition
(RefSeq) RAD54 like (S. cerevisiae)
  KO
K10875  DNA repair and recombination protein RAD54 and RAD54-like protein [EC:3.6.4.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    298429 (Rad54l)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rno03400]
    298429 (Rad54l)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     298429 (Rad54l)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Rad54 family proteins
     298429 (Rad54l)
SSDB
Motif
Pfam: SNF2_N Helicase_C ResIII DEAD Rad54_N HDA2-3 SWI2_SNF2
Other DBs
NCBI-GeneID: 298429
NCBI-ProteinID: NP_001128432
RGD: 1310600
Ensembl: ENSRNOG00000013148
UniProt: B5DFE8
Position
5q35
AA seq 748 aa
MRRSLAPSQLARRKPEDISSDDEDWQPETVTPKKRKSTAETQAQQCFLSPFRKPLTQLLN
RPPCLDSSQHEAFIRSILSKPFKVPIPNYQGPLGSRALGLKRAGVRRALHDPLEEGALVL
YEPPPLSVHDQLKLDKEKLPVHVVVDPILSKVLRPHQREGVKFLWECVTSRRIPGSHGCI
MADEMGLGKTLQCITLMWTLLRQSPECKPEIEKAVVVSPSSLVKNWYNEVEKWLGGRIQP
LAIDGGSKDEIDRKLEGFMNQRGARVPSPILIISYETFRLHVEVLKKGNVGLVICDEGHR
LKNSENQTYQALDSLNTSRRVLISGTPIQNDLLEYFSLVHFVNSGILGTAHEFKKHFELP
ILKSRDAAASEADRQLGEERLRELISIVNRCLIRRTSDILSKYLPVKIEQVVCCRLTPLQ
TELYKRFLRQAKPEEELHEGKMSVSSLSSITSLKKLCNHPALIYDKCVAEEDGFEGTLGI
FPPGYNSKAVEPQLSGKMLVLDYILAMTRSRSSDKVVLVSNYTQTLDLFEKLCRARRYLY
VRLDGTMSIKKRAKVVERFNSPSSPDFVFMLSSKAGGCGLNLIGANRLVMFDPDWNPAND
EQAMARVWRDGQKKICYIYRLLSAGTIEEKIFQRQSHKKALSSCVVDEEQDVERHFSLGE
LKELFTLDEASLSDTHDRLHCRRCVNNRQVWPPPDGSDCTSDLAQWNHNTDKRGLQDEVL
QAAWDASSTAITFVFHQRSHEEQRGLHC
NT seq 2247 nt   +upstreamnt  +downstreamnt
atgaggaggagcttagctcccagccaattggccaggaggaaaccagaagacatatcgtct
gatgatgaagactggcagcctgagacagtaacccctaaaaaacgcaagtccactgccgag
acccaggcccagcagtgtttcctgtctccttttcggaagcccttgactcagttactcaac
cgaccgccttgtctggatagcagtcagcatgaagcgtttatccgaagtattttgtcaaag
cctttcaaggtccccattccaaattatcaaggtcccctgggctctcgagcattgggcctg
aagagggctggcgttcgtcgtgccctgcatgaccctctggaagaaggtgccttggtcctg
tatgagcctcccccactgagcgtccatgaccaactgaagcttgacaaagaaaaactccct
gttcacgtggttgtagatcctattctcagtaaggtgttgcgacctcatcagagagaggga
gtgaagttcctttgggagtgtgtcaccagtcgacgaattcctggaagccatggctgcatc
atggctgatgagatgggcctaggaaagacactgcagtgcatcacattgatgtggacactt
ttgcgccagagcccagagtgcaagccagaaattgagaaagcagtggtggtctcaccttcc
agcctggtgaagaactggtacaatgaggttgagaaatggcttggagggaggatccaacct
ctggccatcgacggaggctcaaaggatgagatagaccgaaaactggaaggattcatgaac
cagcgtggagctagggtgccttcccccatcctcatcatctcctatgagactttccgcctg
catgttgaagttcttaaaaaaggaaacgttggactggtcatatgtgacgagggccacagg
ctaaagaactctgagaaccagacttaccaggctctggacagtctgaataccagccggcgg
gtgctcatctccgggacccccatccagaacgatttgcttgaatatttcagcttggtgcac
ttcgttaattcaggcattttgggaactgcccatgaattcaagaagcattttgaattacca
attttgaagagtcgagatgcagctgccagtgaggcagataggcagcttggagaggaacgt
ttgcgggagctcatcagtattgtgaacaggtgcctgatacggagaacatctgatatcctc
tctaagtatctgccagtgaagattgagcaggtggtttgttgtaggctgacaccccttcaa
actgagctatacaagagatttctaagacaggctaagcctgaagaagaattgcatgagggc
aagatgagtgtatcttccctgtcttctatcacctctctaaagaagctgtgtaatcatcca
gctctaatctatgacaagtgtgtggcagaggaggatggctttgagggcactttgggtatc
ttcccccctggttataactctaaagctgtagaaccacagttgtcgggtaagatgctggtc
cttgactacattctggccatgactcgaagccgtagcagtgacaaagtcgtgctggtgtca
aattatactcagacattggatctctttgaaaagctgtgccgggctcgaaggtacttgtat
gttcgcctggatggcacgatgtccattaagaagcgagccaaagttgtggagcgcttcaat
agcccatcgagccctgatttcgttttcatgctgagcagcaaagctggaggctgtgggctt
aacctcattggtgctaaccggctggtcatgtttgatcctgactggaatccagccaatgat
gaacaagctatggcccgagtctggcgagacggtcaaaagaagatctgctatatctaccga
ctgctctctgcaggaacaattgaggaaaagatctttcagcggcaaagccacaagaaggct
ctgagcagctgtgtggtagatgaggagcaggatgtggaacgtcacttctctcttggtgag
ctcaaagagctgtttaccctggatgaagccagcctcagtgacactcacgacagactgcat
tgccgccgttgtgtaaataaccgccaggtctggccaccccctgatggttctgactgcact
tcagacctggctcagtggaaccataacacagataaacgagggctccaggatgaggtactc
caggctgcctgggatgcttcatctacagccatcaccttcgtcttccaccagcgttcccat
gaggagcagcggggtcttcactgctaa

DBGET integrated database retrieval system