KEGG   Rattus norvegicus (rat): 298682
Entry
298682            CDS       T01003                                 

Symbol
Atad3a
Name
(RefSeq) ATPase family AAA domain-containing protein 3
  KO
K17681  ATPase family AAA domain-containing protein 3A/B
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    298682 (Atad3a)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Other Mitochondrial DNA replication factors
    298682 (Atad3a)
SSDB
Motif
Pfam: DUF3523 AAA RuvB_N Zot AAA_24 AAA_22 Mg_chelatase AAA_16 AAA_33 ATPase Sigma54_activ_2 AAA_5 NACHT AAA_7 AAA_18 RNA_helicase AAA_lid_3 AAA_11
Other DBs
NCBI-GeneID: 298682
NCBI-ProteinID: NP_001030094
RGD: 1305964
Ensembl: ENSRNOG00000018118
UniProt: Q3KRE0
Position
5
AA seq 591 aa
MSWLFGIKGPKGEGTGPPLPLPPAQPGAESGGDRGAGDRPSPKDKWSNFDPTGLERAAKA
ARELEHSRHAKEALNLAQMQEQTLQLEQQSKLKEYEAAVEQLKSEQIRVQAEERRKTLNE
ETRQHQARAQYQDKLARQRYEDQLKQQQLLNEENLRKQEESVQKQEAIRRATVEREMELR
HKNEMLRVEAEARARAKADRENADIIREQIRLKAAEHRQTILESIRTAGTLFGEGFRAFV
TDWDKVTATVAGLTLLAVGVYSAKNATSVAGRYIEARLGKPSLVRETSRISVLEALRHPI
QVSRRLVSRPQDALEGVILSPSLEARVRDIAIATRNTKKNKSLYRNVLMYGPPGTGKTLF
AKKLALHSGMDYAIMTGGDVAPMGREGVTAMHKVFDWASTSRRGLLLFVDEADAFLRKRA
TEKISEDLRATLNAFLHRTGQHSNKFMLVLASNQPEQFDWAINDRIDEMVCFALPQREER
ERLVRMYFDKYVLKPATEGKQRLKVAQFDYGKKCSEVAQLTAGMSGREIAQLAVAWQAMA
YSSEDGVLTEAMMDARVQDAVQQHQQKMQWLKVERPDSEASKPPHPSLLSC
NT seq 1776 nt   +upstreamnt  +downstreamnt
atgtcgtggctcttcggcatcaagggccccaagggagaaggcacagggcctccgctgccc
ttgccgcccgcccaacctggggcggaaagtggcggcgaccgtggtgcgggagatcggcca
tcgcccaaggacaaatggagcaacttcgacccgacgggcctggagcgtgcggccaaagcg
gcgcgcgagttggagcactcgcgccatgccaaggaggcactgaatcttgcacagatgcag
gagcagacactgcagctggaacaacagtctaagctcaaggaatatgaagctgccgtagag
cagctgaagagcgagcagatccgcgtgcaagccgaggaaagaaggaaaaccctgaacgaa
gagacgcggcagcaccaggctagggcccagtaccaggataagctagcccgacaacgctat
gaggaccagctgaaacaacagcaacttctgaatgaagagaatttaaggaaacaagaggaa
tctgtgcagaagcaggaggccatacggcgagccactgtggagcgagagatggagctgcgg
cataagaatgagatgttgcgggtggaagctgaggctcgagcacgggccaaggccgatcga
gagaatgcagacatcatccgggaacagattcgactcaaggctgctgagcaccgccagacc
atcttggagtctatcaggacagccggcaccttgtttggtgaaggattccgtgcctttgtg
acagactgggacaaagtgacagccacggtggctggattgacactattagctgttggagtc
tattctgccaagaacgctacttctgttgctggacggtatattgaggcccgattgggaaag
ccgtccctggtgagagagacctcccgtatctcagtgctggaggcattgaggcatcccatc
caggtcagcaggcggctggtcagcagaccccaggatgcgttggagggcgtcatcctcagt
cctagcctggaggcacgggtccgagatattgccatcgcaacaagaaataccaagaagaac
aaaagcctgtacagaaacgttctgatgtatgggccaccagggactggcaagacactattt
gctaagaaactcgcactgcattcaggcatggactacgccatcatgacaggcggggacgtg
gcccccatggggcgggagggtgtgactgccatgcacaaggtcttcgactgggcaagcacc
agcagacgaggcctcctgctctttgtggatgaagcagatgccttcctcaggaagcgagca
actgaaaagataagtgaagacctcagggctactctgaatgcattcctacacaggacagga
caacacagtaataagttcatgctggtcctggccagtaaccagcctgagcagttcgattgg
gccatcaatgaccgcattgacgagatggtctgctttgccctgccacagcgggaggagcgg
gagcgcctggtgagaatgtattttgacaagtatgtccttaagccggccacagaaggaaag
caacgcttgaaggtggcccagtttgactacggaaagaagtgctcagaggtcgcccagctg
acggcgggaatgtcaggccgggagatagctcagcttgccgtggcatggcaggccatggca
tattcgtctgaggatggggtcctcacggaggctatgatggatgcccgtgtgcaggatgct
gtccagcagcaccagcagaagatgcagtggcttaaagtagagagacctgactctgaggcc
agcaagccaccacatccgtcactcctcagctgctga

DBGET integrated database retrieval system