KEGG   Rattus norvegicus (rat): 29885Help
Entry
29885             CDS       T01003                                 

Gene name
Rab3ip, RABIN3
Definition
(RefSeq) RAB3A interacting protein
  KO
K16779  Rab-3A-interacting protein
Organism
rno  Rattus norvegicus (rat)
Brite
Membrane trafficking [BR:rno04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    29885 (Rab3ip)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    29885 (Rab3ip)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sec2p FAM76 UPF0242 DUF3584 GCN5L1 Spc7 GAS
Motif
Other DBs
NCBI-GeneID: 29885
NCBI-ProteinID: NP_059009
RGD: 620650
Ensembl: ENSRNOG00000005362
UniProt: A1L127
Position
7q22
AA seq 460 aa AA seqDB search
MANDPLEGFHEVNLASPTSPDLLGVCDPGTQEQTTSPSVIYRPHPSTLCSATIQANALNL
SDLPTQPVYSSPRHLNCAEISNISIHVPEPASSVASEVAAGLTRFTSRKDSCNAEREFLQ
GATVTEASAGNDDIFGLSTDSLSRLRSPSVLEVREKGYERLKEELAKAQRELKLKDEECE
RLSKVRDQLGQELEELTASLFEEAHKMVREANVKQATAEKQLKEAQGKIDVLQAEVAALK
TLVLSSSPTSPTQEPLAAGKTPFKRGHTRNKSTSSAMSGSHQDFSAIQPIVKDCREADLS
LYNEFRSWKDEPTMDRTCPFLDKIYQEDIFPCLTFAKSELASAVLEAVENNTLSIEPVGL
QPIRFVKASAVECGGPKKCALTGQSKPCKHRIKLGDSSSYYYISPVCRYRITSVCNFFTY
IRYIQQGLVKQQDVDQMFWEVMQLRKEMSLAKLGYFKEEL
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggctaacgaccccttagaaggtttccatgaagtgaacctcgcttcgcctacctctcca
gaccttcttggtgtgtgtgacccgggaacccaagagcagactacctccccgagcgtcatc
taccggccacacccttcgacgttgtgctctgccactatccaggccaatgccttaaatctt
tctgaccttcccacacagcctgtgtattcatccccgaggcatttaaactgtgcagaaata
tctaacatcagcattcatgttccagagccagcatcatcggtagcctctgaggtggcagca
gggctcacgaggttcacctcaaggaaggacagctgcaacgcagagagggagtttctgcag
ggcgccaccgtcacagaggcttctgctggcaacgatgacatctttgggttgagcacggac
agcctgtcccgtttacggagcccatctgttctggaagttagagagaagggctacgaaagg
ttaaaagaagaacttgcaaaagctcagagggaattgaagttaaaagatgaagaatgtgag
agactttcgaaagtgcgagatcaacttgggcaggagttggaagaactcacagctagttta
tttgaggaagctcacaagatggtgagagaggcgaacgtcaagcaggcaactgcagaaaag
cagctgaaggaagctcaagggaaaattgatgtgcttcaagccgaagtggctgcgctgaag
acactcgtactgtccagttctccaacatcgcctacgcaggagcctctggcggctggaaag
acgccctttaaaagggggcacacacggaacaaaagtacaagcagtgctatgagtggcagc
caccaggacttcagtgcgatccagccaatcgtaaaagactgcagagaggccgatctatcg
ctgtataatgagttcaggtcttggaaggatgagcccacaatggacagaacatgtcccttc
ctagacaaaatctatcaggaggatatctttccatgcttaacattcgcgaaaagtgagttg
gcttcagctgttctggaggccgtggagaacaacactctaagcatcgagccggtagggttg
cagcccatccgcttcgtgaaggcttccgcggtggagtgcggagggccaaaaaagtgtgct
ctcactggccagagtaagccctgtaagcacaggattaaactaggggactccagcagctat
tactacatctctccggtttgcagataccggatcacttctgtatgtaacttttttacatac
attcgatatattcagcagggacttgtgaaacagcaggatgttgatcagatgttctgggaa
gttatgcaactaagaaaggagatgtcgttggcaaagctgggatatttcaaagaagaactc
tga

DBGET integrated database retrieval system