KEGG   Rattus norvegicus (rat): 298878
Entry
298878            CDS       T01003                                 

Gene name
Osr1, Odd1
Definition
(RefSeq) odd-skipped related transciption factor 1
  KO
K09215  odd-skipped
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    298878 (Osr1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    298878 (Osr1)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_jaz C1_4 Zn-ribbon_8 XPA_N zf-AN1 GAGA zf-met CpXC DUF4379
Other DBs
NCBI-GeneID: 298878
NCBI-ProteinID: NP_001100186
RGD: 1311807
Ensembl: ENSRNOG00000004210
UniProt: B0K011
Position
6q14
AA seq 266 aa
MGSKTLPAPVPIHPSLQLTNYSFLQAVNGLPTVPSDHLPNLYGFSALHAVHLHQWTLGYP
AMHLPRSSFSKVPGAVSSLMDARFQLPAFPWFPHVIHPKPEITAGGSGAALKTKPRFDFA
NLALAATQEDPTKLGRGEGPGSPAGGLGALLDVTKLSPEKKPTRGRLPSKTKKEFVCKFC
GRHFTKSYNLLIHERTHTDERPYTCDICHKAFRRQDHLRDHRYIHSKEKPFKCQECGKGF
CQSRTLAVHKTLHSQVKELKTSKIKC
NT seq 801 nt   +upstreamnt  +downstreamnt
atgggcagcaaaaccttgccagcaccggtgcccatccacccatccctgcagcttaccaat
tactctttccttcaggcagtgaatggcttacccacagtgccctcggaccacctgcccaac
ctgtatggtttcagcgctcttcacgcggtgcatctgcaccaatggacgctgggctaccca
gccatgcacttgcctcgttcctctttttctaaagtgccaggtgcggtgtccagcctaatg
gacgctcgcttccagctgccagcttttccctggtttccacacgtcattcaccctaagcca
gagatcaccgcgggaggcagcggtgcagcgcttaagaccaagccgcgctttgatttcgct
aacctggccttggctgccacacaagaggatcccaccaagcttggccgaggggagggccct
ggctcccctgctggtgggctgggcgccctcctggacgtgaccaagctgtctccagaaaag
aagccaacaaggggtcgcctgccttccaagaccaagaaggaattcgtctgcaagttctgt
ggccgccacttcactaagtcctataacctacttatccacgagcggacgcacaccgatgag
cggccttacacctgtgacatctgccacaaagctttccggaggcaagaccacctacgggac
cacagatatattcactccaaagagaagcctttcaagtgtcaagagtgtggaaaaggattc
tgccagtcccggactctcgctgtccacaagacgctacactcacaagtgaaggagctcaaa
acctccaagatcaaatgctaa

DBGET integrated database retrieval system