KEGG   Rattus norvegicus (rat): 299116
Entry
299116            CDS       T01003                                 

Gene name
Sav1
Definition
(RefSeq) salvador family WW domain containing protein 1
  KO
K16686  scaffold protein salvador
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04390  Hippo signaling pathway
rno04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    299116 (Sav1)
   04392 Hippo signaling pathway - multiple species
    299116 (Sav1)
SSDB
Motif
Pfam: WW
Other DBs
NCBI-GeneID: 299116
NCBI-ProteinID: NP_001091050
RGD: 1307253
Ensembl: ENSRNOG00000005264
UniProt: A4V8B4 B1WBL9
Position
6q24
AA seq 387 aa
MLSRKKTKNEVSKPAEVQGKYVKKETSPLLRNLMPSFIRHGPTIPRRTDLCLPESSASAF
SASGDGVVSRNQSFLRTPVQRTPHEVMRRESNRLSAPSSYLVRSLADVPREYGSSQSFLT
EVNFAVENGDSGSRYFYSDNFFDGQRRRPLGDRAQEDYRYYEYNHDLFQRMPQNQGRHTS
GIGRVTATSLGNLTNHGSEDLPLPPGWSVDWTMRGRKYYIDHNTNTTHWSHPLEREGLPP
GWERVESSEFGTYYVDHTNKRAQYRHPCAPSVPRYDQPPPITYQPQQTERNQSLLVPANP
YHTAEIPDWLQVYARAPVKYDHILKWELFQLADLDTYQGMLKLLFMKELEQIVKLYEAYR
QALVTELENRKQRQQWYAQHHGKKFLS
NT seq 1164 nt   +upstreamnt  +downstreamnt
atgctgtcccgcaagaaaaccaaaaacgaggtgtctaagccggccgaggttcagggcaag
tacgtgaagaaggagacgtcgcccctgctgcggaatctcatgccttcattcattcggcac
ggtccaacaattccaagacggactgacctctgtcttccagagtcaagcgctagtgctttc
tcagcttctggagatggcgtagtttcaagaaaccagagtttcctgagaactccagttcaa
aggacgcctcatgaagtaatgagaagagaaagcaacagactgtccgcaccgtcttcttac
cttgtcaggagcctagcggatgtccctcgggaatacggctcatcacagtcatttttaaca
gaagttaattttgctgttgaaaatggagactctggttcccgatatttttattcagataac
ttttttgatggtcagagaaggaggccacttggagatcgtgcacaagaagactatagatat
tatgaatacaaccatgatctcttccaaagaatgccacagaatcaggggaggcacacatca
ggtattgggagagtcactgctacatctttaggaaatttaactaaccatggatctgaagat
ttaccccttcctcctggctggtctgtggactggacaatgagagggagaaaatactacata
gatcataacacaaacacaactcattggagtcatcctcttgaacgagaaggacttcctcct
gggtgggagcgagtggaatcatcagaatttggaacctattatgtggatcacacaaataaa
agggctcagtacaggcacccctgtgctcccagtgtgcctcggtatgatcagcctccaccc
atcacgtatcagccacagcaaactgaaagaaatcagtctctcctggtccctgcaaacccc
taccatactgcagaaattcctgactggcttcaggtttatgcccgagcccctgtgaaatac
gaccacattctgaagtgggagctcttccagctggctgacctggacacgtaccagggaatg
ctgaagctgctcttcatgaaggagctggagcagattgtcaagttgtatgaggcctacaga
caggctcttgtcaccgagctggaaaaccgcaagcagaggcagcagtggtatgcccagcac
catggcaagaagtttttaagttaa

DBGET integrated database retrieval system