KEGG   Rattus norvegicus (rat): 299206Help
Entry
299206            CDS       T01003                                 

Gene name
Batf, B-ATF
Definition
(RefSeq) basic leucine zipper ATF-like transcription factor
  KO
K09034  ATF-like basic leucine zipper transcriptional factor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    299206 (Batf)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    299206 (Batf)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    299206 (Batf)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf APG6_N Sec34 Phlebovirus_NSM TMCO5 HALZ DUF3450 AAA_11 CtIP_N Atg14 Seryl_tRNA_N DUF5320
Motif
Other DBs
NCBI-GeneID: 299206
NCBI-ProteinID: NP_001100218
RGD: 1304923
Ensembl: ENSRNOG00000008588
UniProt: D4A7E1
Position
6q31
AA seq 125 aa AA seqDB search
MPHSSDSSDSSFSRSPPPGKQDSSDDVRKVQRREKNRIAAQKSRQRQTQKADTLHLESED
LEKQNAALRKEIKQLTEELKYFTSVLSSHEPLCSVLASGTPSPPEVVYSAHAFHQPHISS
PRFQP
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgcctcacagctccgacagcagcgactccagcttcagccgctctcctccccccggcaag
caggactcatccgatgatgtgaggaaagttcagaggagagagaagaaccgcattgctgcc
cagaagagccgacagagacagacacagaaggccgacacccttcacctggagagcgaggac
ctggagaaacagaatgcggctcttcgaaaagagatcaaacagctcacagaggagctaaag
tacttcacatcggtgctgagcagccacgagcccctgtgctccgtgctagccagtggcacc
ccctcgccccccgaggtggtatacagcgcccatgccttccaccagcctcacatcagctca
ccacgcttccagccctga

DBGET integrated database retrieval system