KEGG   Rattus norvegicus (rat): 300721
Entry
300721            CDS       T01003                                 

Gene name
Dnaja4
Definition
(RefSeq) DnaJ heat shock protein family (Hsp40) member A4
  KO
K09505  DnaJ homolog subfamily A member 4
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    300721 (Dnaja4)
Chaperones and folding catalysts [BR:rno03110]
 Heat shock proteins
  HSP40 / DNAJ
   300721 (Dnaja4)
SSDB
Motif
Pfam: DnaJ_C DnaJ DnaJ_CXXCXGXG Anti-TRAP
Other DBs
NCBI-GeneID: 300721
NCBI-ProteinID: NP_001020582
RGD: 1310035
Ensembl: ENSRNOG00000012106
UniProt: Q4QR73
Position
8q24
AA seq 555 aa
MPRGNQQPQDLDTTAEGSHPLQHPQKCNNPRQTPEHTPAVTEQKAATPRGRGRVGPARTL
PFQSKLSSAQGSRTRGPPASQRISERPNPGDPRKGKGPASGRRDSRQRPTSTTKPESSTP
KTPATEHPNMARGGNQNWSSGESDGQPEEQTSEENGDKMVKETQYYDILGVKPSASPEEI
KKAYRKLALKYHPDKNPDEGEKFKLISQAYEVLSDPKKRDIYDQGGEQAIKEGGSGSPSF
SSPMDIFDMFFGGGGRMTRERRGKNVVHQLSVTLEDLYNGITKKLALQKNIICEKCEGIG
GKKGSVEKCPLCKGRGMQIHIQQIGPGMVQQIQTVCIECKGQGERINPKDRCEDCSGAKV
TREKKIIEVHVDKGMKDGQKILFHGEGDQEPELEPGDVIIVLDQKDHSVFQRRGHDLIMK
MKIQLSEALCGFKKTIKTLDDRVLIISSKSGEVIKHGDLKCVRNEGMPIYKAPLEKGMLI
IQFLVVFPEKQWLSLEKLPQLEALLPPRQKVRITDDMDQVELKEFNPNEQSWRQHREAYE
EDDDGPRAGVQCQTA
NT seq 1668 nt   +upstreamnt  +downstreamnt
atgcctagggggaaccagcaaccacaggatctcgacaccaccgcagaaggcagccatcca
ctccaacaccctcaaaaatgcaacaatccgaggcagaccccagagcacacccccgcagtg
accgaacagaaggcggccacaccccgaggcagaggccgggtggggccagcacgcacgctg
cccttccagtccaagctctcctccgcccagggttcgcgcacacgaggccctcctgcaagc
cagcggatctcagagcggcctaaccccggggacccacgcaagggcaaggggccagcctcg
gggcggcgtgacagccggcagcggccaacctccaccacgaagcccgaatcctccacgccg
aaaacccccgccaccgagcatcccaacatggcccgtggcggcaatcagaactggagctcc
ggggagtcggacggccagccagaggagcagacttccgaggagaacggagacaagatggtg
aaggagacccagtactatgacatcctgggggtgaagcccagcgcgtccccggaggagatc
aagaaggcctatcggaagctggcgctcaagtaccacccagacaagaacccggatgagggc
gaaaagtttaaacttatatcccaggcatatgaagtactttcagatccaaagaaaagagac
atctatgaccaaggtggagaacaggcaattaaagaagggggatcgggtagccccagcttc
tcttcacccatggatatctttgacatgttttttggtggtggagggcggatgactagagag
agaagaggcaagaatgttgtacaccagctgtcagtaactctggaagacttatataatgga
atcactaagaaactggccctccagaaaaatataatttgtgagaaatgtgaaggcattggt
gggaagaagggatccgtggagaagtgccctctgtgcaaggggcgggggatgcagatccat
atccagcagatcgggccgggcatggtgcagcagatccagactgtgtgcatcgagtgcaag
ggccagggcgagcgtatcaaccccaaggaccgctgtgaggactgcagcggtgccaaggtt
acccgagagaagaagattatcgaggtacacgtggataaaggtatgaaggatgggcaaaag
atactgtttcatggagaaggagatcaggagcctgagctggaacctggtgatgtcataatt
gtgcttgatcagaaggatcatagtgtctttcagagacgaggccatgatttgatcatgaaa
atgaaaattcagctctctgaagctctttgtggcttcaagaagacaataaaaacgctggat
gatcgagtcctcatcatttcgtctaagtcaggtgaggtgataaagcatggagacctcaag
tgtgtccgcaatgaggggatgcccatctacaaagcccccctggagaaggggatgcttatc
atacagttcttagtagtcttccctgaaaaacagtggctttctctagagaagcttcctcag
ctggaggctctgcttccccctcggcagaaggtgaggatcacagatgatatggatcaggtg
gagctgaaggagttcaaccccaacgagcagagctggcgccagcacagggaggcctatgag
gaggacgacgatgggccccgcgctggcgtgcagtgccagacagcatga

DBGET integrated database retrieval system