KEGG   Rattus norvegicus (rat): 300955Help
Entry
300955            CDS       T01003                                 

Gene name
Nck1
Definition
(RefSeq) NCK adaptor protein 1
  KO
K07365  NCK adaptor protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04012  ErbB signaling pathway
rno04360  Axon guidance
rno04660  T cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    300955 (Nck1)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    300955 (Nck1)
  09158 Development and regeneration
   04360 Axon guidance
    300955 (Nck1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SH3_1 SH3_9 SH3_2 SH2 SH3_3 SH3_10 hSH3 SH2_2
Motif
Other DBs
NCBI-GeneID: 300955
NCBI-ProteinID: NP_001100321
RGD: 1310688
UniProt: B2RZ33
Position
8q31
AA seq 377 aa AA seqDB search
MAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGFVPSNYVERKN
SARKASIVKNLKDTLGIGKVKRKPSVPDTASPADDSFVDPGERLYDLNMPAFVKFNYMAE
REDELSLIKGTKVIVMEKCSDGWWRGSYNGQIGWFPSNYVTEEGDSPLGDHVGSLSEKLA
AVVNNLNTGQVLHVVQALYPFSSSNDEELNFEKGDVMDVIEKPENDPEWWKCRKINGMVG
LVPKNYVTVMQNNPLTSGLEPSPPQCDYIRPSLTGKFAGNPWYYGKVTRHQAEMALNERG
HEGDFLIRDSESSPNDFSVSLKAQGKNKHFKVQLKETVYCIGQRKFSTMEELVEHYKKAP
IFTSEQGEKLYLVKHLS
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagaagtggtggtggtggccaaatttgattatgtggcacagcaggaacaagag
ctggatatcaagaagaatgagagattatggctcctggatgactctaagtcctggtggcga
gttcgaaattccatgaataaaacaggttttgtcccttctaactatgtggaaagaaaaaat
agtgctcggaaagcatctattgttaaaaacctgaaggacaccttaggcattggaaaagtg
aaaagaaaacccagtgttccagatacggcatctcctgctgatgatagctttgttgatcca
ggagaacgtctctatgacctcaacatgcctgcttttgtgaagtttaactacatggctgag
agagaggatgaattgtcattgataaaagggaccaaggtgatagtcatggagaaatgcagt
gacggatggtggcgtggcagctacaatggacaaattggatggttcccttcaaactatgta
actgaagaaggtgacagtcctttgggtgaccatgtaggttctctgtcagagaagttagca
gcagttgtcaataacctaaatacaggtcaagtattgcacgttgtacaggctctttacccg
ttcagctcatccaatgatgaagaactcaattttgagaaaggtgatgtaatggatgttatt
gaaaagccggaaaatgacccagaatggtggaaatgcaggaaaatcaatggcatggttggc
ctggtgccaaaaaactatgttaccgtcatgcagaataatccgctaacctcaggtttggaa
ccatcgcctccacagtgtgattacattaggccttcactcacggggaagtttgctggcaat
ccttggtattatggcaaagtcaccaggcaccaggcagagatggcattgaatgaaagaggg
catgaaggagacttcctcattcgcgacagtgagtcttcgccaaatgatttctcagtatca
ctaaaagcacaagggaaaaacaagcattttaaagtccagctgaaagagactgtctactgc
attgggcagcggaaattcagcaccatggaggaacttgtagaacattacaaaaaggcaccg
atctttacaagtgaacaaggagagaaattgtatctcgtcaagcatttgtcttga

DBGET integrated database retrieval system