KEGG   Rattus norvegicus (rat): 301081Help
Entry
301081            CDS       T01003                                 

Gene name
Zdhhc3
Definition
(RefSeq) zinc finger, DHHC-type containing 3
  KO
K20029  palmitoyltransferase ZDHHC3/7/25 [EC:2.3.1.225]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    301081 (Zdhhc3)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     301081 (Zdhhc3)
Membrane trafficking [BR:rno04131]
 SNARE
  SNARE associated proteins
   Palmitoyltransferases
    301081 (Zdhhc3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC DUF898 DUF3615
Motif
Other DBs
NCBI-GeneID: 301081
NCBI-ProteinID: NP_001034103
RGD: 1309041
Ensembl: ENSRNOG00000004344
UniProt: Q2TGK3
Position
8q32
AA seq 299 aa AA seqDB search
MMLIPTHHFRDIERKPEYLQPEKCAPPPFPGPVGTMWFIRDGCGIACAIVTWFLVLYAEF
VVLFVMLIPSRDYAYSIINGIVFNLLAFLALASHCRAMLTDPGAVPKGNATKEFIESLQL
KPGQVVYKCPKCCSIKPDRAHHCSVCKRCIRKMDHHCPWVNNCVGENNQKYFVLFTMYIA
LISLHALIMVGFHFLHCFEEDWTKCSSFSPPTTVILLILLCFEALLFLIFTSVMFGTQVH
SICTDETGIEQLKKEERRWAKKTKWMNMKAVFGHPFSLGWASPFATPDQGKADPYQYVV
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgatgcttatccccactcatcacttccgagacattgaacggaaaccagaatacctccag
ccagagaagtgtgccccacctcccttccctggccccgtgggaaccatgtggtttatccgc
gatggctgtggcatcgcctgtgccattgtcacctggtttctggtcctctatgcagagttt
gtagtcctctttgtcatgctgattccatcccgagactacgcatacagtatcatcaacgga
attgtgttcaacctgctggccttcttggctctggcctcccactgccgggccatgctgacg
gaccccggggcagtgcccaaaggaaatgccactaaagagttcatcgagagccttcagctg
aagcctgggcaggtggtgtacaagtgtcccaagtgctgcagcatcaagcccgaccgggca
caccactgcagtgtttgtaagcggtgcattcgcaagatggaccaccactgtccttgggtc
aacaactgtgtcggcgagaacaaccagaagtactttgtcctgttcacaatgtacatagct
ctcatttccttgcacgccctcatcatggtgggattccacttcctgcattgctttgaagaa
gactggacaaagtgcagctccttctcaccgcccaccactgttatcctgctcatcctgctg
tgttttgaggccctgctcttcctcattttcacatcagtgatgtttgggacccaagtgcac
tccatctgcacagatgagacgggaatagaacaattgaaaaaggaagagagaagatgggct
aaaaaaacaaagtggatgaacatgaaagccgtttttggccaccctttctctttaggctgg
gccagcccctttgccacaccagaccaagggaaggcagacccgtaccagtatgtggtctga

DBGET integrated database retrieval system