KEGG   Rattus norvegicus (rat): 301415
Entry
301415            CDS       T01003                                 

Gene name
Ankrd44, RGD1561893
Definition
(RefSeq) ankyrin repeat domain 44
  KO
K15503  serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    301415 (Ankrd44)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rno03400]
    301415 (Ankrd44)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-6
    Regulatory subunits
     301415 (Ankrd44)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   Other DSBR factors
    Protein phosphatase 6
     301415 (Ankrd44)
SSDB
Motif
Pfam: Ank_2 Ank_4 Ank Ank_5 Ank_3
Other DBs
NCBI-GeneID: 301415
NCBI-ProteinID: NP_001178736
RGD: 1561893
Ensembl: ENSRNOG00000021384
UniProt: F1LZH9
Position
9q31
AA seq 993 aa
MAVLKLCDQPPLVQAIFSGDPEEIRLLIHKTEDVNALDSEKRTPLHVAAFLGDAEIIELL
ILSGARVNAKDNMWLTPLHRAVASRSEEAVQVLIKHSADVNARDKNWQSPVHVAAANKAV
KCAEVIIPLLSSVNVSDRGGRTALHHAALNGHMEMVNLLLAKGANINAFDKKDRRALHWA
AYMGHLDVVALLINHGAEVTCKDKKGYTPLHAAASNGQINVVKHLLNLGVEIDEINVYGN
TALHIACYNGQDAVVNELIDYGANVNQPNNSGFTPLHFAAASTHGALCLELLVNNGADVN
IQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCVDKDGNTPLHVAARYGHELLINTLIT
SGADTAKCGIHSMFPLHLAALNAHSDCCRKLLSSGFEIDTPDTFGRTCLHAAAAGGNVEC
IKLLQSSGADFHKKDKCGRTPLHYAAANCHFHCIKALVTTGANINETDNWGRTALHYAAA
SDMDRNKMILGNAHDNSEELERAREVKGKDAALCLEFLLQNDANPSIRDKEGYNSIHYAA
AYGHRQCLELLLERTNTGFEESDGGALKSPLHLAAYNGHHQALEVLLQSLVDLDIRDEKG
RTALYLAAFKGHTECVEALVNQGASIFVKDNVTKRTPLHASVINGHTLCLRLLLEIADNP
EVVDVKDAKGQTPLMLAVAYGHIDAVSLLLEKEANVDAVDTVGCTALHRGIMTGHEECVQ
MLLEQEASILCKDSRGRTPLHYAAARGHATWLNELVQIALSEEDCCLKDNQGYTPLHWAC
YNGNENCIEVLLEQKCFRKFIGNPFTPLHCAIINGHESCASLLLGAIDSSIVSCRDDKGR
TTLHAAAFGDHAECLQLLLRHDAQVNAVDNSGKTALMMAAENGQAGAVDILVNSAQADLT
VKDKDLNTPLHLAISKGHEKCALLILDKIQDESLINAKNSALQTPLHIAARNGLKVVVEE
LLAKGACVLAVDENASRSNGPRSPPGTAVRKEE
NT seq 2982 nt   +upstreamnt  +downstreamnt
atggcagtgctcaaactctgcgatcagccacctctggtccaggcaatcttcagtggcgac
ccagaggagattcgcctgctcatccataagactgaagatgtgaacgcactggattctgag
aaacgaaccccgcttcatgtggctgcattcctgggagatgcagagatcatcgagctcctg
attttgtcaggagctcgcgtaaatgccaaggacaacatgtggctgaccccactgcaccgg
gctgttgcttccagaagtgaagaggcagtgcaagtattgattaaacactcggctgacgtc
aatgcaagggacaagaattggcagagccccgtccatgtggcagcagccaataaggctgtc
aagtgtgcagaagtgatcattccactcctgagcagtgtcaatgtctctgacagaggggga
cgcacagccttgcaccatgcggctctgaacggacacatggagatggtcaatttactcttg
gccaaaggggcaaacatcaatgcatttgacaagaaggaccggcgtgctctccactgggca
gcatacatgggccacctggatgttgtggcactgctcattaaccatggcgcagaagtgacc
tgcaaggataagaagggctataccccactgcacgctgcagcctccaatgggcagatcaat
gttgtcaaacatctcctgaacctgggggtggagattgatgaaatcaatgtctatggaaac
acagcacttcacattgcctgctacaatggccaggatgctgtcgttaatgagctgatcgac
tacggcgctaacgtgaaccagcctaacaacagtggcttcacccctctgcactttgcagcg
gcgtctactcacggtgctctgtgtctggaactgttagtcaacaatggggccgatgtgaac
attcagagtaaggatggcaaaagtcctctgcacatgacggctgtccatgggcggttcaca
cggtcacaaaccctcattcagaatggaggtgaaatcgactgtgtggataaggatggcaac
acacctctccatgtggctgcaagatatggtcacgagctcctgattaacaccctaataact
agcggagctgacacagccaagtgtggaatccatagcatgttccccctccatttagctgcc
ctaaatgctcactctgactgctgcaggaagttgttatcctctggctttgaaatagacacc
ccagatacgtttggaagaacgtgcctccacgccgctgctgcaggaggcaatgtagaatgt
ataaagctcttgcagagcagcggagcggattttcacaaaaaggacaaatgtgggaggacc
cctttgcactatgcagctgcaaattgtcatttccactgtattaaagcattagtgaccacc
ggagccaatatcaatgaaacagacaactggggacggacagctttgcactacgctgctgca
tcagacatggatagaaataagatgatcttaggcaacgcccatgacaattctgaagaactt
gaaagggccagggaagtgaaggggaaggacgccgcgctatgtctagagtttctgcttcag
aacgatgcaaacccatccatccgggacaaggaaggctacaatagcatccattatgctgcg
gcctatggccacaggcagtgtctagaactgcttttggaaagaaccaacactggttttgaa
gaatcagacggcggtgctctcaagagtccactccacttagcggcctacaatgggcaccac
caagccttggaggtccttctccagtccctagtggacctggacatcagggatgagaaaggc
cggacggccctgtacctagctgctttcaagggacacacagaatgtgtggaagcacttgtt
aaccagggcgcatccatcttcgtgaaagacaatgtcaccaaaagaactccacttcatgcc
tcggttattaatggtcacacgctgtgtttgaggctactacttgaaatagcggacaacccg
gaagtggttgatgtgaaggatgccaagggacaaaccccactgatgcttgcagtagcatat
ggacacattgatgccgtttcgttgttacttgaaaaggaagcaaacgtagatgctgttgac
acagtgggctgcacagctttacatagagggatcatgacaggacatgaggaatgtgtgcaa
atgctgctggaacaagaagcatccatcctctgtaaagactccagagggaggacacccctg
cactatgccgctgcccggggccacgccacgtggctgaatgagttggtccagattgcgctt
tctgaagaggactgttgcctcaaagacaaccagggatacacgccgctgcactgggcctgt
tacaatggtaatgaaaattgcatagaggtacttttggagcaaaaatgttttcgaaaattt
attggtaatcccttcactccactgcactgtgcaataataaacggtcatgagagctgtgca
tcactgctcctgggggccatagattccagcattgtcagctgtagggatgacaaaggcagg
acaaccctccatgcggcagcctttggggatcatgcagaatgcttgcagctgcttctgagg
catgacgctcaagtgaatgccgtagataattcagggaaaacagcgctgatgatggccgct
gagaacgggcaggcaggcgctgtggatattttggtgaacagtgcccaggctgacctgact
gtgaaagataaggacctgaacacgcccttgcacctggctatcagtaaaggccatgagaaa
tgtgccttgttaatacttgacaagatacaagacgagagccttatcaacgcgaaaaacagt
gcattgcagacacccctccatattgctgcacgcaatggcttgaaggtggtagttgaggag
ctgctggctaaaggagcctgtgtacttgccgtagatgaaaatgcttctaggtcgaatgga
ccccgttctccacctggaacagctgtacgaaaagaagaatga

DBGET integrated database retrieval system