KEGG   Rattus norvegicus (rat): 301476Help
Entry
301476            CDS       T01003                                 

Gene name
Ikzf2, Zfpn1a2
Definition
(RefSeq) IKAROS family zinc finger 2
  KO
K09220  IKAROS family zinc finger protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    301476 (Ikzf2)
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    301476 (Ikzf2)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     301476 (Ikzf2)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    301476 (Ikzf2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-H2C2_5 zf-C2H2_jaz zf-C2H2_6 GAGA zf-MYND zf-C2H2_11 zf-C2HE zf-met zf-TRAF DUF3268 zf-CHCC
Motif
Other DBs
NCBI-GeneID: 301476
NCBI-ProteinID: NP_001100386
RGD: 1308686
Ensembl: ENSRNOG00000027430
UniProt: D4A7Y7
Position
9q33
AA seq 313 aa AA seqDB search
MFFNQRTISFHCTLTMETDGIDGYITCDNELSPEGEQATMAIDLTSSTPNGQHASPGHMT
STNSVKLEMQSDEECDRQPLSREDEIRGHDEGSSLEDPLIESGEVADNRKVQDLQGEGGI
RLPNGKLKCDVCGMVCIGPNVLMVHKRSHTGERPFHCNQCGASFTQKGNLLRHIKLHSGE
KPFKCPFCSYACRRRDALTGHLRTHSVGKPHKCNYCGRSYKQRSSLEEHKERCHNYLQNV
SMEAAGQVMSHHVPPMEDCKEQEPIMDNNISLVPFERPAVIEKLTANMGKRKSSTPQKFV
GMRHLLPLGRSWL
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgttttttaatcaaaggacaatttcttttcactgcactttgactatggaaacggacgga
attgatggctacataacgtgtgacaatgagctttcacctgaaggggagcaggccaccatg
gccattgacctcacttcaagcacacccaatggacagcacgcctcgccaggtcacatgaca
agcacaaattctgtaaagctggaaatgcagagtgatgaagagtgtgacaggcagcccctg
agccgtgaggacgagatcaggggccacgatgaggggagcagcctagaagatcccctaatt
gagagcggcgaggtggccgacaacaggaaagtccaggaccttcaaggcgagggaggaatc
cggcttccgaatggtaaactgaaatgtgacgtctgtggcatggtttgcattgggcccaat
gtgcttatggtacataaacggagtcacactggtgagcggcccttccactgtaaccagtgt
ggagcttcttttacccagaagggcaaccttctgagacacataaagttacactctggagag
aagccgttcaaatgtcctttctgtagctatgcttgtagaagaagggacgctctcacagga
cacctcaggacccactctgtgggtaaacctcacaagtgtaactactgtggccgaagctac
aagcagcgcagctcactggaggaacacaaggaacgctgtcacaactatctccagaatgtc
agcatggaggctgccgggcaggtcatgagtcaccatgtcccgcccatggaagattgtaag
gaacaagagcctatcatggacaacaatatttctctggtgccttttgagagacctgctgtc
atagagaagctcacggccaatatgggaaagcgcaaaagctccaccccgcagaagtttgtg
ggaatgagacatctactgccacttggacgttcatggctttga

DBGET integrated database retrieval system