KEGG   Rattus norvegicus (rat): 301562
Entry
301562            CDS       T01003                                 

Gene name
Col4a4
Definition
(RefSeq) collagen type IV alpha 4 chain
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: Collagen
Other DBs
NCBI-GeneID: 301562
NCBI-ProteinID: NP_001008333
RGD: 1305355
Ensembl: ENSRNOG00000014851
Vega: OTTRNOG00000001047
UniProt: Q5U1X9
Position
9q34
AA seq 159 aa
MRCFFRWTESYGTGPWSLIFILFTIQYEYGSSKKYGSPCGGRNCSVCQCFPEKGSRGHPG
PLGPQGPIGPLGPPGPIGIPGEKGLRGDSGLPGPPGEKGDKGPTGVPGFPGVDGVPGHPG
PPGPRGKPGMDGYNGSRGDPGYPGERGAPGPGGPPVRHH
NT seq 480 nt   +upstreamnt  +downstreamnt
atgaggtgctttttcagatggaccgagtcctacggcacaggcccctggtcactgatattt
atcctctttaccatacaatatgaatatgggagcagcaagaaatatggcagcccctgtgga
ggaagaaactgctctgtctgccagtgtttccctgaaaagggatctcggggtcacccagga
ccactgggaccacagggaccaatagggcccttgggacccccaggacccattgggattcca
ggagaaaaaggactgagaggtgacagcggcctgcctggaccaccaggagagaaaggagac
aagggtccaactggtgtgcccggatttccaggcgtggatggtgtacctggtcacccaggg
cctcctggacccagaggcaaacctggtatggacggctacaatggctcacgaggtgatccg
ggctatccaggagagagaggagctcctggccctggcggcccccctgtaagacaccattag

DBGET integrated database retrieval system