KEGG   Rattus norvegicus (rat): 301617
Entry
301617            CDS       T01003                                 

Gene name
Pask
Definition
(RefSeq) PAS domain containing serine/threonine kinase
  KO
K08801  PAS domain containing serine/threonine kinase [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    301617 (Pask)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     301617 (Pask)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   301617 (Pask)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PAS_9 PAS Kinase-like PAS_8 Pkinase_fungal PAS_2 Kdo
Other DBs
NCBI-GeneID: 301617
NCBI-ProteinID: NP_001009362
RGD: 1306146
Ensembl: ENSRNOG00000016888
UniProt: Q5PQT0
Position
9q36
AA seq 1385 aa
MEDRGPPVLAEDWKSESLPAQEGPATQAFVEPSKPLSIAHRHLNRKNGLSRLCQSRMALS
EDRWSSYCLSSLAAQNICTSKLHCAATPDYADPIAGPLGSTSCCSLLRGLASGCSGPLLS
TPVCNPNKAVFTVDAKTTEILVANDKACSLLGYSSHDLIGQKLTQFFLKSDSEVVEALSE
EHVEADGHAAVVFGTVVDIVSRSGEKIPVSVWIKRLQQDRGLCCVVVLEPVERVSAWVAF
QSDGTITSCDSLFAHLHGFTSPKDVVGQCVIDLIPSIQLPPPGQHVPKSLKIQRSVGRAR
DGTTFPLSLKLKSKTSGKAVAESEVASEPGYQASVWVFCTISGLITLLPDGTIYGINHSF
ALMLFGYGKTELLGKNITCLIPGFYHCMDLAYDSSVQLPDLVNCLDIGSKSGPGEMSSDA
KQDWELASGAQDPRIDVLTRGHMPSQDETLKLRGGQVSPRTQTQLETGRHILPSCASQPS
LGVDSSPVDGERSLPTDQRNVPKRNLLAHAEQLLSQTQPDTLEISPPVLKELSEIQKNIS
EESPLTHRKWLLSKAQKDTTKGSLPIHDEKLLLASQHIHVLGKENPSAAESYREGLLAES
RSKPVDAKPFASCEDSELLVPAKDRSNRADMSSLQQEAQLELMGISSPGSPNPWADATMP
EPHTTGQIPGGSLTYCPQHRSEWILQQRGQDSAPSPSAMGCVFVGTPTLDEPWPGVRNDR
EELQTCLIKEQLSKSSFGGALGISCVELVPAEHPPFTAPVSFCDWGGRDLHASRSGSSSA
CYALATDLPGVLEAVEAQEADVSSYSWNLRELFLNDRTDRTPSHCSCTTSELSETPSLSG
VGSDLDVGILHRQTSDILAHREMLLLSGTYFDLREGHRFQEMGAGHDGAELSNISLVSSE
HYETSDIESLGCDPPIPDPGPNNMCLSAEKPRLSAQITSTPVAPGPTSLQQEIQEGIFSG
SCYHRDGLRLSVQFEVKRVQLQGSATLFCCWLVKDFLHSHRDSATRTRLFLASLPSSTHS
MPDLSGSSFGEMLRAKPWFEESPTPAELEGLAACEGEYSHKYNTLRPLGSGAFGFVWTAV
EKEGNKEVVVKFIKKEKVLEDCWVEDPKLGRVPLEISILSKVEHANIIKIVDVFENQGFF
QLVMEKHGSGLDLFAFIDRHPCLDEPLASYIFRQLVSAVRYLRSQGIIHRDIKDENIVIA
EDFTIKLIDFGSAAYLEKGKLFYTFCGTIEYCAPEVLIGNPYRGPELEMWSLGVTLYTLI
FEENPFCEVEETMEAVIHPPFLVSQELMSLLSGLLQPCPEQRTTLEKLIVDPWVTQPVNL
DNYTWEEVCRTSQPESGLMSAASLELASRSPSEVAQTEGLCRPPAPKEAPGNHCLHLEDP
SSPVS
NT seq 4158 nt   +upstreamnt  +downstreamnt
atggaggacagaggtccaccagttcttgctgaggactggaagtctgagagtcttcctgcc
caagagggcccagctacccaggctttcgttgagcccagcaagcctctctccatagcccat
agacacctgaacaggaagaatgggctttctagactctgccagagccgaatggcactctcc
gaggataggtggagctcttactgtctttcatcattggctgcccaaaacatctgcacaagc
aaactgcactgcgctgctacacctgactatgctgaccctatagctggcccactgggcagt
acatcgtgctgctccttgctacgtggcctagcttcagggtgctctggacctctgctctcg
acccctgtgtgcaaccctaacaaggctgtctttactgtggatgccaagaccacagagatt
ctggttgccaatgacaaagcctgcagcctcctggggtatagcagtcatgacctgattggc
caaaagcttacacagttcttcctcaagtctgattccgaggttgtggaagccctcagcgag
gagcatgtggaggctgatggccacgctgcagtagtgttcggcacggtggtggacattgtc
agccgaagtggggagaagattcccgtctctgtgtggataaagaggttgcaacaagatcgt
ggcttgtgctgtgtagtggttctggagcctgtggagagggtctcagcctgggtcgccttc
cagagtgatggaactatcacgtcatgcgacagcctctttgctcatcttcatgggttcaca
tctccaaaggatgtggttgggcagtgtgtcatagacttgattccatctatacagctccct
cctcctggccaacatgtcccaaagagtctcaagattcaaaggtctgttgggagagccaga
gacgggaccaccttccctctcagtctgaagttgaaatctaagaccagtggaaaggctgta
gctgaaagtgaggtggcctcagaaccaggttaccaggcttctgtgtgggtgttctgcacc
atcagtggcctcatcactctcctgcctgatggcacaatttatggcatcaaccacagcttt
gcactaatgttgtttggttatggaaaaacagagctcctgggcaagaacatcacttgcctg
attcctggtttctaccactgcatggaccttgcatatgatagttctgtccagctgccagat
ctggtcaactgcctggacattggcagcaagagtgggcctggggagatgagttctgatgcc
aagcaggactgggagctggccagtggggcccaagatccaagaattgatgtgttgacacgg
ggccacatgccatcacaagatgagaccctgaagctgcggggaggacaagtctcgcctagg
actcagactcagctggaaactggacgccacatacttccttcttgtgcatctcagccctcc
ctgggggtagacagcagcccagtggacggtgagcggtcattacccacagaccagcggaac
gttccaaagagaaacctgctagcccatgctgaacagttactatctcagacccaaccagac
accctggaaatatccccaccagtccttaaagaactgtctgaaattcagaaaaatatctca
gaagaaagcccactaacccacaggaaatggttattgtccaaggcccagaaagacaccaca
aaaggaagcctgccaatccatgatgagaagttactgcttgcaagccagcatatccatgtc
ttgggaaaggaaaatccttcagcagcagagagctacagggagggtcttttagcagaaagc
aggtccaaaccagtggatgcaaaaccgtttgcttcatgtgaagattctgagcttctagtc
ccagctaaggacagaagcaacagagcggacatgagtagtctgcaacaggaagctcaattg
gagctgatgggtatcagtagtcccggtagtcctaacccctgggctgatgccaccatgcct
gagccccacaccacagggcagataccaggagggagcctgacatactgcccacagcataga
agcgagtggatcttacaacagcgaggccaggactcggctcccagcccctctgcaatgggg
tgtgtctttgttgggacacccactctggatgaaccatggccaggagtgagaaatgatcga
gaagagctgcagacttgcttgattaaggaacagttgtccaagtcaagctttgggggagct
ctaggaatctcctgtgtggaacttgtcccagcagaacatcctcctttcactgcccccgtg
tccttctgtgattggggaggccgagacctacatgctagccgctcaggcagctcctcagcc
tgctatgctttggccactgacctccctggtgtcttggaggcagtggaagcccaggaggct
gatgtgagttcttattcctggaacctcagggagctctttctcaatgaccggacagacaga
actccatcacattgttcctgtaccacttctgaacttagcgagacaccatctctttcaggg
gtggggtcagatttagatgtgggtattctgcacaggcagacttcagatattttagctcac
cgagagatgttgcttcttagtgggacctattttgaccttagggaaggccatcggttccag
gagatgggagcaggacatgatggagcagaactgtctaacatttctttggtatcctctgaa
cactatgaaactagtgacatagaaagcctaggttgtgaccctcccataccagatcctggt
cctaacaatatgtgcctatcagcagagaagcctagactgagtgcccagatcacttccact
cctgtggcacctgggcccaccagcctgcagcaggagatccaggagggcatcttctctgga
agctgctaccaccgagatggcttacgactgagtgtacagtttgaagtaaagcgtgtgcag
ctccagggctctgcaaccctgttctgctgctggctggtgaaggacttcttacacagtcac
cgggactcagccacccgaacccgcctgttccttgccagcctgccaagctctacccactcc
atgcctgacctctctggatccagctttggagagatgctcagagccaagccttggtttgag
gagtccccaacacccgcagagctggaggggctggcagcctgtgagggcgagtactcccat
aagtacaacaccctgcgcccactcggcagtggcgcctttggctttgtgtggactgcagtg
gagaaggaaggcaacaaagaggtggtggtgaagtttattaagaaggagaaggttttagag
gattgttgggttgaagatcccaaacttggaagagttcctttagagatttcaattctgtcc
aaggtggaacatgccaacataatcaagattgtggatgtattcgaaaaccaagggttcttt
cagctagtgatggaaaagcatggctctggcttggacctctttgctttcattgaccgtcat
ccctgcttggatgagcccctggcgagttacatcttccgacaactggtgtctgctgtaaga
tacttgcgttcccaaggcatcatccatagagacatcaaggatgagaacattgtgattgct
gaggacttcacaattaagctgatagattttggctcagctgcctacttagagaagggcaaa
ctattttataccttttgtggaacaattgaatactgtgcacctgaagttctcattggaaat
ccctacagagggccagagctggagatgtggtctctcggggtcacgctgtacacgctcatc
ttcgaggagaatcccttctgtgaggtggaggagaccatggaggcagttattcatcccccc
ttcctggtttcccaagaacttatgagtcttctgtctgggctgctgcagccttgccctgag
cagcggaccactttggagaagctgattgtggacccctgggtgacacagcctgtgaacctt
gataactacacctgggaagaggtgtgtcggaccagccagccagaaagtggcctgatgtca
gctgcaagtctggagcttgcgagtaggagtccaagtgaagtggctcagacagagggtctt
tgtagacctcctgctcccaaggaggctcctggtaaccactgcttgcatcttgaggatccc
tcgtcaccagtcagctga

DBGET integrated database retrieval system