KEGG   Rattus norvegicus (rat): 302557
Entry
302557            CDS       T01003                                 

Gene name
Pqbp1
Definition
(RefSeq) polyglutamine binding protein 1
  KO
K12865  polyglutamine-binding protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    302557 (Pqbp1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rno03041]
    302557 (Pqbp1)
Spliceosome [BR:rno03041]
 Complex B
  Other components
   Prp19 complex
    302557 (Pqbp1)
SSDB
Motif
Pfam: WW
Other DBs
NCBI-GeneID: 302557
NCBI-ProteinID: NP_001013979
RGD: 1549750
Ensembl: ENSRNOG00000007766
UniProt: Q6PCT5
Position
Xq12
AA seq 263 aa
MPLPVALQTRLAKRGILKHLEPEPEEEIIAEDYDDDPVDYEATRIEGLPPSWYKVFDPSC
GLPYYWNVETDLVSWLSPHDPNFVVSKSAKKLRNSNADAEDKSERNLEKVDRNHEKSDRS
HEKPDRSHEKADRNHEKSDRERERNYDKVDRERDRDRERERAFDKADREDGKDRRHHRRE
ELAPYPKNKKATSRKDEELDPMDPSSYSDAPRGTWSTGLPKRNEAKTGADTTAAGPLFQQ
RPYPSPGAVLRANAEASRSKQQD
NT seq 792 nt   +upstreamnt  +downstreamnt
atgcctctccctgttgcgctgcagacccgcttggcaaagaggggcatcctcaaacatctg
gagccagagccagaggaagagattattgctgaggattacgatgatgatcctgttgactat
gaggccaccaggatagaaggtctgccaccaagctggtacaaggtgtttgacccttcttgt
ggactcccttactattggaatgtggagacagacctcgtgtcctggctctcaccacatgat
cccaactttgtggttagcaaatctgccaagaaactcaggaacagtaatgcagatgctgag
gacaagtcggagcggaatcttgaaaaggttgacagaaatcatgagaagtcagatcgtagt
cacgagaagccagacagaagccatgagaaggcagaccgaaaccacgagaagtctgaccga
gaacgagagcggaactatgacaaggtagacagagagagagatcgggatagggaacgagaa
cgggcatttgacaaggcagaccgggaagatggcaaagaccggcgccaccatcgcagagag
gaactggctccttaccccaagaacaagaaagcgacgagccggaaagatgaagaattagac
cccatggaccccagctcatactcagatgcaccccggggcacatggtcaacaggactaccc
aagaggaatgaggccaagactggggctgacacgacagcggctgggcctctcttccagcag
cgcccatacccttcccctggggctgtgctccgcgccaatgcagaagcctcccgcagcaaa
cagcaggactga

DBGET integrated database retrieval system