KEGG   Rattus norvegicus (rat): 303285
Entry
303285            CDS       T01003                                 

Gene name
Traf4
Definition
(RefSeq) TNF receptor-associated factor 4
  KO
K09848  TNF receptor-associated factor 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04657  IL-17 signaling pathway
rno05200  Pathways in cancer
rno05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    303285 (Traf4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    303285 (Traf4)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    303285 (Traf4)
SSDB
Motif
Pfam: zf-TRAF zf-C3HC4 zf-C3HC4_2 zf-RING_UBOX zf-RING_5 zf-Nse zf-TRAF_2 zf-RING_2 zf-RING_6 zf-C3HC4_4 MATH zf-rbx1
Other DBs
NCBI-GeneID: 303285
NCBI-ProteinID: NP_001100487
RGD: 1306708
Ensembl: ENSRNOG00000013169
UniProt: B1WC90
Position
10
AA seq 470 aa
MPGFDYKFLEKPKRRLLCPLCGKPMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPEDQLP
LDYAKIYPDPELEVQVLGLAIRCIHSEEGCRWSGPLRHLQGHLNTCSFNVVPCPNRCPAK
LSRRDLPAHLQHDCPKRRLKCEFCGCDFSGEAYESHEGVCPQESVYCENKCGARMMRRLL
AQHATSECPKRTQPCAYCTKEFVYDTIQSHQYQCPRLPVPCPNQCGVGTVAREDLPTHLK
DSCSTAFVLCPFKESGCKHRCPKLAMGRHVEESVKPHLAMMCALVSRQRQELQELRRELE
ELSVGSDGVLIWKIGSYGRRLQEAKAKPNLECFSPAFYTHKYGYKLQVSAFLNGNGSGEG
THLSIYIRVLPGAFDNLLEWPFARRVTFSLLDQSDPGLAKPQHVTETFHPDPNWKNFQKP
GTWRGSLDESSLGFGYPKFISHQDIRKRNYVRDDAVFIRASVELPRKILS
NT seq 1413 nt   +upstreamnt  +downstreamnt
atgcccggcttcgactacaagttcctggagaagcccaagcggcggctgctgtgcccactg
tgcgggaaacccatgcgcgagcctgtgcaggtgtccacttgcggccaccgcttctgcgac
acctgcctgcaggagttcctcagtgaaggagtcttcaaatgccctgaagaccagcttcct
ctggactatgccaagatctacccggacccagagctggaggtgcaggtgttaggcttggct
atacgctgcatccacagtgaggagggctgccgctggagcgggccacttcgtcacctacag
ggccacttgaacacttgcagcttcaatgtagtcccctgcccgaatcgctgcccggccaag
ctgagccggcgcgacctgcccgcccacctgcagcacgactgccctaagcgccgcctcaag
tgtgaattctgtggttgtgacttcagtggggaggcctacgagagtcacgagggtgtgtgc
ccccaagagagtgtgtactgtgagaacaagtgtggtgcccgcatgatgaggcgactgttg
gcccagcacgccacttctgagtgccccaagcgcacccagccctgtgcctactgtaccaag
gagtttgtttatgacaccatccagagccaccagtaccagtgcccacgcctgcctgttccc
tgccccaaccagtgtggagtgggcactgtggcccgggaggacctgcccacccatctgaag
gatagctgcagcactgccttcgtgctctgccctttcaaagagtctggctgcaagcacagg
tgccctaagctggcaatgggacgtcatgtggaggaaagtgtaaagccacatctggctatg
atgtgcgccctggtgagccggcagcggcaagagctgcaggagctgcgcagagagctggag
gagctatctgtgggtagtgatggagtgctcatctggaagatcggcagctatgggcgtcgc
ctacaggaggccaaggccaagcctaacctggagtgcttcagcccagccttctatacacat
aagtacggttacaagctgcaggtgtctgcgttccttaacggcaatggcagtggggagggt
acgcatctctccatctacatccgtgtgctgccaggcgcctttgacaatctcctcgagtgg
ccttttgcacgacgggtcaccttctccctgctggatcagagtgacccaggtttggctaag
ccacagcatgtcacggagaccttccaccctgatccaaactggaagaacttccagaagcct
ggcacttggcgaggttccctggatgagagttctctgggctttggctaccccaaattcatt
tcccaccaggacatccgaaaacgaaattacgtgcgggatgatgcagttttcatccgtgcc
tctgtcgaactgccccggaagatcctcagctga

DBGET integrated database retrieval system