KEGG   Rattus norvegicus (rat): 303350
Entry
303350            CDS       T01003                                 

Gene name
Rnf135, LRRGT00184
Definition
(RefSeq) ring finger protein 135
  KO
K16272  E3 ubiquitin-protein ligase RNF135 [EC:2.3.2.27]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    303350 (Rnf135)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     303350 (Rnf135)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    303350 (Rnf135)
SSDB
Motif
Pfam: SPRY zf-C3HC4_4 zf-C3HC4 zf-RING_UBOX zf-C3HC4_3 PRY zf-RING_2 zf-C3HC4_2 zf-RING_5 Prok-RING_4 Big_3_3 ALIX_LYPXL_bnd COMM_domain zf-MIZ zf-RING_10
Other DBs
NCBI-GeneID: 303350
NCBI-ProteinID: NP_001012010
RGD: 1305252
UniProt: Q5M929
Position
10q25
AA seq 415 aa
MAAACPGTAVPVWLSEEDLSCIICQGLLDWPTTLPCGHSFCLQCLKDLWVSKRAGVDSCP
WACPICRKGPSAKPVLHKNPLLQDLVDKYRQAALELEAGPEPAPVPRSLCTPTPPQVTVQ
KSTTQVVQELTELVGQLVDIVKSLQTQRPSLASGLDNALGILHMDSSSEEEYPLDSPKLV
TFSASQKKIQEILRDLEKIQETLQGSVTGNEAPKKQVEEMASSVGLLPDQRYPVSRKASQ
FSLWAISPTFDLRSLSCNLEVSNNCRMVTVSRALQPYHWSSERFSISQVLCSQAFSSGQK
YWEVDTRNCSHWAVGVASWGMKRDKMLGRTMDSWCIEWRGPSQFSAWAMMKKTDLSSGPP
EVVGVWLDLELGKLAFYSVADQERPLYECEVSSSSPLHPAFWLYGLTPGNYLEIL
NT seq 1248 nt   +upstreamnt  +downstreamnt
atggcagccgcttgtcctggcaccgcagtaccggtatggctgagcgaggaagacctgagc
tgcattatctgccaaggactgctggactggcccaccaccctgccctgcggccacagcttc
tgtctccagtgcctcaaagacctgtgggtctcgaagcgcgcgggcgtggatagctgccct
tgggcctgccccatatgccggaagggcccctcggcgaagcccgtgctgcataagaacccg
ctgctgcaagacctggtggacaagtaccgccaagcggcgctggagttggaggctggtccc
gaacccgcccctgtgccccgttctctgtgtacacctacaccgccccaggtgacagtacag
aaaagcactacacaagttgtccaggagctgactgagctggtgggacagcttgtagacatt
gtcaagagccttcaaacgcaaagacctagcttggcatctggactggacaatgctctaggc
atcctgcacatggattcttcctctgaggaggaatatcccttggattctccaaagctggtg
actttcagtgcgtctcagaagaaaattcaggagattctccgtgacctagaaaaaattcag
gaaaccctgcaagggagtgtcacggggaacgaagctcctaaaaaacaagttgaggaaatg
gcatcttctgtaggcctgctgcctgaccagaggtatcctgtatccaggaaagcgtctcag
ttttccctatgggccatcagtccaacctttgacctgaggagcctctcctgtaacctggag
gtttccaacaattgccgaatggtgaccgtgtctcgggctctacaaccctatcattggagt
tccgagagattctcaattagccaggtcttatgctctcaggccttctcttctgggcagaag
tactgggaagtggacactcggaactgcagccactgggctgttggggtggcttcttggggc
atgaagcgggacaagatgctgggaaggaccatggactcttggtgtatagagtggagaggg
cccagccagttctctgcttgggccatgatgaagaaaacagacttgtcctcaggccctcct
gaggttgtgggcgtgtggcttgacctggagctggggaagcttgccttctactcagtggct
gatcaggagaggcctctgtatgagtgtgaggtctccagctcctctcctctgcatcctgcc
ttctggctgtatggcttaactcctggaaactacctggaaatactgtaa

DBGET integrated database retrieval system