KEGG   Rattus norvegicus (rat): 303382
Entry
303382            CDS       T01003                                 

Gene name
Rasl10b
Definition
(RefSeq) RAS-like, family 10, member B
  KO
K07851  Ras-like protein family member 10B
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:rno04031]
    303382 (Rasl10b)
GTP-binding proteins [BR:rno04031]
 Small (monomeric) G-proteins
  Ras Family
   Others
    303382 (Rasl10b)
SSDB
Motif
Pfam: Ras Roc MMR_HSR1 AAA_16 AAA_14 CSN7a_helixI DUF815
Other DBs
NCBI-GeneID: 303382
NCBI-ProteinID: NP_001178577
RGD: 1310873
Ensembl: ENSRNOG00000010302
Vega: OTTRNOG00000000500
UniProt: D3ZU35
Position
10q26
AA seq 203 aa
MVSTYRVAVLGARGVGKSAIVRQFLYNEFSEVCVPTTARRLYLPAVVMNGHVHDLQILDF
PPISAFPVNTLQEWADACCRGLRSVHAYILVYDICCFDSFEYVKTIRQQILETRVIGTSE
TPIIIVGNKRDLQRGRVIPRWNVSHLVRKTWKCGYVECSAKYNWHILLLFSELLKSVGCA
RCKHVHAALRFQGALRRNRCAIM
NT seq 612 nt   +upstreamnt  +downstreamnt
atggtctccacctaccgggtggccgtgctgggggcgcgaggtgtgggcaagagtgccatc
gtgcgccagttcttatacaacgagttcagcgaggtctgtgtgcccaccaccgcccgccgc
ctctacctgcctgctgtggtcatgaatggccatgtgcacgacctgcagatcctggacttc
ccacccatcagcgccttccctgtcaacacactgcaggagtgggcagatgcctgctgcagg
ggactccgaagcgtccacgcctacatcctggtctatgacatctgctgctttgacagcttt
gagtacgtcaagactatccgtcagcagatcctggagacgagggtgatcggcacctcggag
acacccatcatcatcgtgggcaacaagcgcgacctgcaacgcggacgcgtgattccacgc
tggaacgtgtcgcacttggtgcgcaagacctggaagtgcggctacgtggagtgctcggcc
aagtacaactggcacatcctgctgctcttcagcgagctgctcaagagtgtgggctgcgcc
cgctgcaaacacgtgcacgctgccctgcgctttcagggcgcgctgcgccgcaaccgctgc
gccatcatgtga

DBGET integrated database retrieval system