KEGG   Rattus norvegicus (rat): 303538
Entry
303538            CDS       T01003                                 

Gene name
Dhx58, Lgp2, RGD1310093
Definition
(RefSeq) DEXH-box helicase 58
  KO
K12649  ATP-dependent RNA helicase DHX58 [EC:3.6.4.13]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04622  RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    303538 (Dhx58)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:rno04054]
    303538 (Dhx58)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     303538 (Dhx58)
Pattern recognition receptors [BR:rno04054]
 Cytoplasmic pattern recognition receptors
  RIG-I-like receptors
   303538 (Dhx58)
SSDB
Motif
Pfam: RIG-I_C-RD RIG-I_C ResIII Helicase_C DEAD SWI2_SNF2 AAA_19 AAA_22 zinc_ribbon_4 DUF1871
Other DBs
NCBI-GeneID: 303538
NCBI-ProteinID: NP_001092258
RGD: 1310093
Ensembl: ENSRNOG00000018247
UniProt: D3ZD46
Position
10q31
AA seq 678 aa
MELRPYQWEVILPALEGKNIIIWLPTGAGKTRAAAFVAKRHLETVDRGKVVVLVNRVHLV
NQHAEEFRRMLDKQWTVTTLSGDMGSRAGFGLLARSHDLLICTAELLHLALKSSEEDEHV
ELTEFSLIVVDECHHTHKDTIYNTILSRYLEHKLKKAKPLPQVLGLTASPGTGGATKLQG
AIDHILQLCANLDTWRIMSPKNCYSQLLEHNPKPCKQYDLCQRRTQDPFGDLLKKLMKQI
HQQLEMPDLKQQFGTQMYEQQVVQLSKDAAEAGLQEQRVYALHLRRYNDALYIHDTVRAW
DALNMLQDFYDTERALKTQMVHAERWLLELFDDHRKALAQFAAQGPENPKLEMLEGILLK
QFGSPDHTRGIIFTRTRQTASSLLLWLRQQPCLQTVNIKPQMLIGAGNTGQSTHMTQKDQ
QEVIQEFRDGKLNLLVATSVAEEGLDIAQCNVVVRYGLLTNEISMVQARGRARAGQSVYS
FVATEGSREIKRELTNEALEVLMEQAVAAVQKMDPEEFKAKIQDLQLASLVKRAARAAHR
ESQQGQFPPDRVQLLCINCMVAVGYGSDLRKVEGTHHVNVNPDFSVYYTTSQNPVVINKV
FKDWKPGGIIRCSNCGEVWGFQMIYKSVTLPVLKIRSMLLETPHGKIQAKKWSRVPFSVP
DFDILRDCTQSLSDLSLD
NT seq 2037 nt   +upstreamnt  +downstreamnt
atggagctgcgaccctaccagtgggaagtgatcttacctgctctggagggcaagaacatc
attatatggcttcccacgggtgctgggaagacccgggcagctgcctttgtggccaagagg
catctagagacagtagaccgaggcaaggtggtggtactggttaatagggtacacctggtg
aaccagcatgccgaggagttcaggcgcatgttggataaacaatggaccgtgacaaccctg
agtggggacatgggatcacgagctggttttggcctattggctcggagccatgacctgctc
atctgtacggcagagttactgcatctggcgctgaagagctctgaggaggatgaacacgta
gagctcacagaattctcgctgattgtggtggacgagtgtcaccatacccacaaggacacc
atctacaacaccatcttgagccggtacctagagcataaactgaagaaggcaaagcccctt
ccccaggtcctgggtctcacagcctccccaggcactggaggagccaccaagctccaaggg
gccattgaccacatcctacagctctgtgcgaatttggatacgtggcgcatcatgtcaccg
aagaattgctactcccagctgctggagcataacccaaagccctgcaagcagtatgacctc
tgccaaaggcgcacgcaggatccttttggagacttgctaaaaaagcttatgaagcaaatc
caccaacaactagagatgcctgacctgaagcagcagttcggaacccagatgtatgagcag
caagtggtacagttaagcaaggacgcggcagaggctgggctccaggaacagcgggtgtat
gcgctgcatttgcggcgctacaatgatgctctatatatccacgatacggtccgtgcgtgg
gacgcacttaacatgttgcaagatttctacgacacagaacgcgccctaaaaacacagatg
gtgcatgctgagcgctggctgctggagctgtttgatgaccatagaaaagctctggcccag
tttgcagcccaaggtcctgagaacccgaagttggagatgctggaagggatcctactgaag
cagtttgggagtcctgaccacactcggggtatcatcttcaccagaacccgtcagactgct
tcttccctcctgctctggcttcggcagcaaccttgcctacagactgtgaacatcaagccc
cagatgctgattggagcagggaacacaggccagagcacacatatgacccagaaagaccag
caagaggtgatccaggagttcagggatggtaaactgaaccttctagtggccacaagtgta
gcagaggagggcctggatatcgctcagtgcaatgtggtggtgcgctatgggctcctgacc
aatgagatctccatggtccaggctcggggtcgcgctcgagctggtcagagtgtgtactcc
ttcgtggctacagagggcagtcgggagataaagcgggagctgaccaatgaggcactggaa
gtgttgatggagcaggcagtggccgctgtccagaaaatggaccctgaggagttcaaggcc
aagatccaggaccttcagctagcatctctagttaagcgagcagcacgtgcggcccatcgg
gagagccagcaggggcagttcccaccagatcgcgtgcagcttctctgcatcaactgtatg
gtggccgttggctacgggagtgacctgcggaaggtggagggcacccaccacgtcaatgtg
aaccccgacttctcggtctactataccacttcccagaatcctgtggtcattaacaaggtc
tttaaggactggaaacctggaggaatcatcagatgcagtaactgtggagaggtctggggc
ttccagatgatctacaaatcagtgaccttgccggtgctcaaaatcagaagcatgcttctg
gagacccctcacgggaagatccaggccaaaaagtggtcccgagtgcctttctcagtacct
gacttcgacattctgcgggattgcacccaaagcctgtctgatctctcactggactga

DBGET integrated database retrieval system