KEGG   Rattus norvegicus (rat): 303701
Entry
303701            CDS       T01003                                 

Gene name
C1qtnf1, Ctrp1
Definition
(RefSeq) C1q and tumor necrosis factor related protein 1
  KO
K19470  complement C1q tumor necrosis factor-related protein 1/6/8
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    303701 (C1qtnf1)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 C1q domain-containing proteins
  CBLN / gliacolin group proteins
   303701 (C1qtnf1)
SSDB
Motif
Pfam: C1q Collagen
Other DBs
NCBI-GeneID: 303701
NCBI-ProteinID: NP_001007676
RGD: 1359204
Ensembl: ENSRNOG00000003259
UniProt: Q5XIG2
Position
10q32.3
AA seq 281 aa
MGSRGQGFMLGCCLLLAVTWGPVLSLVPRVQEEQQEWEETEELTSPLDHVTRPEETHKRY
SPSLREGLPTSRCYRCCDSNPPVYQTIPPPQINITILKGEKGDRGDRGLQGKYGKIGSTG
PRGHIGPKGQKGSMGAPGDHCKSQYAAFSVGRKKALHSNDYFQPVVFDTEFVNLYNHFNM
FTGKFYCYVPGIYFFSLNVHTWNQKETYLHIMKNEEEVVILYAQVSDRSIMQSQSLMLEL
REQDEVWVRLFKGERENAIFSDEFDTYITFSGYLVKPASEP
NT seq 846 nt   +upstreamnt  +downstreamnt
atgggctcccgtggacagggattcatgctgggatgctgcctgctgctggctgtcacctgg
ggcccggtcctgagccttgtgccacgagttcaggaggaacaacaggagtgggaagagaca
gaggagctgacatctcccctggatcatgtgacaaggcctgaagaaacacacaagaggtat
agccctagcctgcgtgagggcctccccacttcccggtgctatcgatgctgtgattccaac
cctccagtataccagacaatccctccgccccagatcaacatcaccatcctaaaaggtgag
aaaggagaccgaggggatcgaggcctgcaggggaagtatggcaaaataggttctacgggt
cccaggggccacattggccccaaagggcagaagggatctatgggagcccctggggaccac
tgcaagagccagtacgcagccttctctgtgggccgaaagaaggctctgcacagtaacgac
tacttccagcctgtggtcttcgacacggagtttgtgaacctctacaatcacttcaacatg
ttcaccgggaagttctactgctacgtgcccggcatctacttcttcagcctcaacgtgcac
acgtggaaccagaaggagacctacctgcacatcatgaagaacgaggaggaggtcgtgatc
ctgtatgcgcaggtgagcgaccgcagcatcatgcagagtcagagcctgatgctggagctg
cgagagcaggatgaggtatgggtgcgcctcttcaagggcgagcgtgagaacgccatcttc
agtgacgagttcgacacctacatcaccttcagcggctacctggtcaagccggcctccgag
ccctag

DBGET integrated database retrieval system