KEGG   Rattus norvegicus (rat): 303792
Entry
303792            CDS       T01003                                 

Gene name
Klhl22, RGD1306288
Definition
(RefSeq) kelch-like family member 22
  KO
K10459  kelch-like protein 22
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    303792 (Klhl22)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     303792 (Klhl22)
SSDB
Motif
Pfam: Kelch_1 Kelch_6 BTB Kelch_2 Kelch_3 Kelch_4 BACK Kelch_5
Other DBs
NCBI-GeneID: 303792
NCBI-ProteinID: NP_001100549
RGD: 1306288
Ensembl: ENSRNOG00000001878
UniProt: D3ZZC3
Position
11q23
AA seq 634 aa
MAEEQDFAQLCKLSTQPSHSHCVNNTYRSTQHSQALLRGLLALRDSGILFDVVLVVEGRH
IEAHRILLAASCDYFRGMFAGGLKEMEQEEVLIHGVSYNAMCQILHFIYTSELELSLSNV
QETLVAACQLQIPEIIHFCCDFLMSWVDEENILDVYRLAELFDLNRLTQQLDTYILKNFV
AFSRTDKYRQLPLEKVYSLLSSNRLEVSCETEVYEGALLYHYSMEQVQADQISLHEPPKL
LETVRFPLMEAEVLQRLHDKLGPSPLRDTVASALMYHRNESLQPSLQGPHTELRSDFQCV
VGFGGIHSTPSTILSDQAKYLNPLLGEWKHFTASLAPRMSNQGIAVLNNFVYLIGGDNNV
QGFRAESRCWRYDPRHNRWFQIQSLQQEHADLCVCVVGKYIYAVAGRDYHNNLSAVERYD
PATNSWEYVAPLKKEVYAHAGTTLQGKMYITCGRRGEDYLKETHCYDPGSNTWHTLADGP
VRRAWHGMAALLDKLFVIGGSNNDAGYRRDVHQVACYSCTSRQWSSVCPLPAGHGEPGIA
VLDNRIYVLGGRSHNRGSRTGYVHIYDMEKDCWEEGPQLNNSISGLAACVLTLPRSLLHE
QPRGTPNRSQADADFASEVMSVSDWEEFDNSSED
NT seq 1905 nt   +upstreamnt  +downstreamnt
atggctgaggagcaggactttgcccagctgtgcaagctgtccacacagccctcccactca
cactgcgtcaacaatacctatcgaagcacacagcactcccaggccctgctccggggactg
cttgctttgcgagacagtgggatcctctttgatgttgtcctggtggtagaggggaggcac
attgaggcccatcggattctgctggctgcatcatgtgattacttcagaggaatgtttgct
gggggattgaaggaaatggagcaggaagaggtcttgatccatggtgtgtcttacaatgcc
atgtgccagatcctgcacttcatatacacttctgagctagagctgagcctcagcaatgtg
caggagaccctggttgctgcctgccaacttcagataccagaaattatccacttttgctgt
gatttcctcatgtcatgggtcgatgaggagaacatccttgatgtttaccggctggcagag
ctctttgacttgaaccgtctgacccaacagctagatacctacatcctcaaaaactttgtg
gccttctcaagaactgacaagtaccgccagcttcccttggagaaggtctactctctcctc
agcagcaatcgcctggaggtttcctgtgagactgaagtgtatgaaggggccctgctctac
cattactccatggaacaggtgcaggctgaccagatctcactgcatgaaccccccaagctc
ctagagactgtgcgttttcccctgatggaagctgaggtcctccagcggctgcacgacaag
cttggtcctagcccactgagggacacagtggccagtgcccttatgtaccaccggaatgag
agcctgcagcccagccttcagggcccacacacagagcttcgctcagacttccagtgtgtt
gtgggctttgggggcattcactccacaccatctacaatcctcagtgaccaggccaagtac
ctgaatccccttctgggagagtggaaacacttcactgcctctctagcgccccgaatgtcc
aaccagggcattgcagtgctcaacaacttcgtgtacttaattggaggggacaataatgtc
caaggattccgagctgagtcccgatgctggaggtatgacccaagacacaatcgctggttc
cagatccagtccttgcagcaggaacatgcagacttgtgcgtgtgtgtagtggggaagtac
atctacgctgtggcaggccgtgactaccacaataacctgagtgctgtggagcgctatgac
cctgccaccaactcctgggaatatgtggccccactcaagaaggaggtatatgcccatgca
ggcaccacgctgcaagggaagatgtacatcacctgtggtcgcagaggagaggactacctg
aaagagacacactgctatgacccaggaagcaacacgtggcacactctagccgatgggcct
gttcgacgcgcctggcacggcatggctgcgctccttgacaagctgtttgtgattggaggc
agcaacaatgatgccggctacaggagagatgtgcaccaggtggcttgctacagttgtaca
tctcgtcagtggtcatcggtctgcccactgccagctgggcatggtgagcctggcattgct
gtgctagacaacaggatatatgtgctgggcggccgctctcacaaccgaggcagccgcaca
ggctacgtgcacatctacgacatggagaaagactgctgggaagagggaccccagctgaac
aattccatctcaggcctggcagcctgtgtgctcaccctgccccgctctctgctccatgag
caaccccgagggactcccaaccgtagccaggcagatgcagactttgcctctgaggtgatg
agtgtgtctgactgggaagagtttgacaactctagcgaggactag

DBGET integrated database retrieval system