KEGG   Rattus norvegicus (rat): 303831
Entry
303831            CDS       T01003                                 

Gene name
Eif4a2
Definition
(RefSeq) eukaryotic translation initiation factor 4A2
  KO
K03257  translation initiation factor 4A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    303831 (Eif4a2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    303831 (Eif4a2)
   03012 Translation factors [BR:rno03012]
    303831 (Eif4a2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    303831 (Eif4a2)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     303831 (Eif4a2)
   mRNA cycle factors
    Stress granule specific factors
     303831 (Eif4a2)
Translation factors [BR:rno03012]
 Eukaryotic type
  Initiation factors
   eIF-4
    303831 (Eif4a2)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   303831 (Eif4a2)
  Exosomal proteins of bladder cancer cells
   303831 (Eif4a2)
SSDB
Motif
Pfam: DEAD Helicase_C ResIII AAA_19 AAA_30 Helicase_RecD Flavi_DEAD UvrD-helicase tRNA-synt_1b AAA_22
Other DBs
NCBI-GeneID: 303831
NCBI-ProteinID: NP_001008336
RGD: 1309225
Ensembl: ENSRNOG00000001815
UniProt: Q5RKI1
Position
11q23
AA seq 407 aa
MSGGSADYNREHGGPEGMDPDGVIESNWNEIVDNFDDMNLKESLLRGIYAYGFEKPSAIQ
QRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQLEIEFKETQALVLAPTRELAQQIQKV
ILALGDYMGATCHACIGGTNVRNEMQKLQAEAPHIVVGTPGRVFDMLNRRYLSPKWIKMF
VLDEADEMLSRGFKDQIYEIFQKLNTSIQVVLLSATMPTDVLEVTKKFMRDPIRILVKKE
ELTLEGIKQFYINVEREEWKLDTLCDLYETLTITQAVIFLNTRRKVDWLTEKMHARDFTV
SALHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHR
IGRGGRFGRKGVAINFVTEEDKRILRDIETFYNTTVEEMPMNVADLI
NT seq 1224 nt   +upstreamnt  +downstreamnt
atgtctggtggctccgcggattacaacagagaacatggcggcccagagggaatggacccc
gatggtgtcatcgagagcaactggaatgaaattgttgataactttgatgatatgaattta
aaggagtcccttcttcgaggcatctatgcttatggttttgagaagccttcagctattcag
cagagagctataatcccatgtattaaaggatatgatgtgattgctcaagctcagtcaggt
actggcaagacagccacatttgctatttccatcctgcaacagttggagattgagttcaag
gagacccaagcactagtattggcccccaccagagaactggctcaacagatccaaaaggtc
attttggctcttggagattatatgggagcaacttgtcatgcttgcattggaggaacaaat
gttcgaaatgaaatgcagaagttgcaggctgaagcccctcatattgttgttggcactcct
gggagagtatttgatatgctaaacagaagatacctttctccaaaatggatcaaaatgttt
gttttggatgaagcagatgaaatgttgagccgagggtttaaggatcagatctatgagatt
ttccaaaaattaaatacaagcattcaggttgtgttactttctgccacaatgccaactgat
gtcctagaagtgaccaagaaattcatgagagatccaattcgaattctggtgaagaaggaa
gaattgacccttgaaggaattaaacaattttatattaatgttgagcgagaggagtggaag
ctggacactctttgtgacttgtatgagactttgactatcacacaagcagttatttttctc
aatacaaggcgcaaggtggactggctcacggagaaaatgcatgccagggacttcacagtt
tctgctctgcatggtgacatggaccagaaggaaagagatgtcatcatgagggaattccga
tcagggtcaagccgtgttctgatcactactgacttgttggctcgtgggattgatgtgcaa
caagtgtccttggttataaactatgatctacctaccaatcgtgaaaactatattcacaga
attggcagagggggtcgatttgggaggaaaggtgtggctataaactttgttactgaagaa
gacaagaggattcttcgtgacattgagactttctacaatactacagtggaggaaatgccc
atgaatgtggctgacctaatttaa

DBGET integrated database retrieval system