KEGG   Rattus norvegicus (rat): 305083
Entry
305083            CDS       T01003                                 

Gene name
Zfp281
Definition
(RefSeq) zinc finger protein 281
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 FYVE
Other DBs
NCBI-GeneID: 305083
NCBI-ProteinID: NP_001012030
RGD: 1305139
UniProt: Q5XI48
Position
13q13
AA seq 889 aa
MKIGSGFLSGGGGPGSSGGSGSSGSSGSGGSRRAEMEPTFPQSMVMFNHRLPPVTSFTRP
AGTAAPPPQCVLSSSTSAAPAAEPPPPPAPDMTFKKEPAASAAAFPSQRTSWGFLQSLVS
IKQEKPADPEEQQSHHHHHHHHYGGLFAGAEERSPGLGGGEGGSHGVIQDLSILHQHVQQ
QPAQHHRDVLLSSSGSRTDDHGNEEPKQDTNVKKAKRPKPESQGIKAKRKPSASSKPLVG
EGEGAVLSPSQKPHICDHCSAAFRSSYHLRRHVLIHTGERPFQCSQCSMGFIQKYLLQRH
EKIHSREKPFGCDQCSMKFIQKYHMERHKRTHSGEKPYKCDTCQQYFSRTDRLLKHRRTC
GEAIAKGAASAEPGSSNHNNMGNLAVLSQGNTSSSRRKSKSKSIAVENKEHKTGKTNESQ
MSNNINMQSYSVEMPTVSTSGGIIGTGLDELQKRVPKLIFKKGSRKNTDKSYLNFVSPLP
DVAGQKSLSGKPSGSLGIVSNNSVETISLLQSASGKPGPISSNYDDAMQFSKKRRYLPTA
SSNSAFSINVGHMVSQQSVIQSAGVSVLDNEAPLSLIDSSALNAEIKSCHDKSGIPDEVL
QSILDQYSSKSEPQKEDPFNLTEPRVDLHTSGEHSELVQEEHLSPGTQTPSNDKASVLQE
YSKYLQQAFEKSTNAGFTLGHGFQFVSLSSPLHNHTLFPEKQIYTTSPLECGFGQSVTSV
LPSSLPKPPFGMLFGSQPGLYLSALDATHQQLTPSQELDDLIDSQKNLETSSAFQSSSQK
LTSQKEQQKNLESSTSFQIPSQELASQIDPQKDIEPRTTYQIENFAQAFGSQFKSGSRVP
MTFITNSNGEVDHRVRTSVSDFSGYTNMMSDVSEPCSTRVKTPTSQSYR
NT seq 2670 nt   +upstreamnt  +downstreamnt
atgaaaatcggcagcgggttcctcagcggcggcggcggtcccggcagtagcggtggtagc
ggctccagcggcagctccggcagcggcggcagcaggagagctgagatggagcccaccttc
ccccagagtatggttatgttcaaccaccggctccccccggtcaccagcttcacccggcct
gcggggacggccgcccctcccccgcagtgcgtgttatcctcctctacctccgcagccccg
gccgctgagcccccccctccaccagccccggacatgactttcaagaaggagccggcggcg
tcagccgcggccttcccttcgcagaggacctcctggggattcttgcagtccttggtgagc
atcaagcaggagaaacctgcggatcctgaggagcagcagtcccaccaccatcatcaccac
caccactatggggggctgttcgctggggctgaagagagatcaccaggcctaggaggaggg
gaaggggggagccacggcgtcatccaagacctcagtattctccaccagcatgtccagcag
caaccagcccagcatcaccgcgatgtattactgagcagcagcggtagcaggactgatgac
catggcaacgaggagccaaagcaggacactaacgtcaaaaaggcaaagaggccaaagcca
gaatctcagggaatcaaagccaagaggaagccaagtgcatcttccaaacctttggttgga
gagggagaaggtgccgtcctgtccccaagtcagaaacctcatatctgtgatcactgtagt
gctgctttcaggagctcctaccacctgcggagacatgtcctcattcacacaggagaaagg
ccgttccagtgcagccagtgtagtatgggtttcattcagaaatacctactgcagagacac
gagaaaattcacagcagagagaagccctttgggtgcgatcagtgcagcatgaagtttatt
cagaagtaccatatggagagacacaagaggacacatagtggagaaaagccatataagtgt
gacacttgccaacagtatttttcaaggactgacagattgttgaagcacaggcgcacgtgt
ggtgaagccatagcaaaaggggccgctagtgcagaacctgggtcatcaaaccataataat
atgggtaatctggctgtgttgtctcagggaaatacaagttcttcacggagaaaatcgaag
tcaaaaagcatagctgttgaaaataaggaacacaagactggcaaaacaaacgaatcacag
atgtcaaacaatataaacatgcagagttactcagtagaaatgcctactgtgtccaccagt
ggcggcatcatcggcacggggctcgatgagctacagaaaagggtgccaaaactgatcttt
aagaaaggaagcagaaagaatacagataaaagctaccttaattttgtgtcaccgttacca
gatgtagctgggcagaaatccttgtctggtaaaccaagtggctcgcttggcatcgtatcg
aacaatagcgtggagaccattagtcttctccaaagtgcaagcggcaaaccaggcccgata
agtagtaattatgatgatgccatgcagttctcaaagaagagaagatacttaccaactgcc
agcagcaacagtgccttttctatcaatgtaggacacatggtctcccagcagtcagtcatt
cagtctgcaggggtcagtgttttggacaatgaggcgccattgtcacttattgactcctca
gctctaaatgctgaaattaagtcttgtcacgacaagtctggaattcctgatgaggttcta
caaagtattttggatcagtactctagcaagtcagaaccacagaaggaggatcccttcaac
ttaacagaaccacgagtggatttacacacctcaggagaacactctgaattggttcaagaa
gagcatttgagcccaggcacccagacaccttcaaatgacaaagcaagcgtgttgcaggag
tactccaaatacctccagcaggcttttgagaagtccacgaatgcaggttttaccctcgga
catggtttccagtttgtcagcttatcttcacctctccacaaccacactttgtttccagaa
aaacagatatacactacatctcctttggagtgtggttttggccaatctgttacctcagtg
ttgccatcttcattgccaaagcctccttttgggatgttgtttggatctcaaccaggtctt
tatttatctgctttggatgctacacatcagcagttgacaccttcccaggagctggatgat
ctgatagattctcagaagaacttagagacatcatcagccttccagtcctcatctcagaaa
ttgactagccagaaggaacaacagaaaaatttagagtcctcaacaagctttcagattcca
tctcaggagttagctagccagattgatcctcagaaagacatagagcctagaacaacgtac
cagattgagaactttgcacaagcattcggttctcagtttaagtcgggcagcagggtgcca
atgacctttatcactaactctaatggagaagtggaccatagagtaaggacttcagtgtca
gatttctcagggtatacaaatatgatgtctgatgtaagtgagccatgtagtacaagagta
aagacacccaccagccagagttacaggtaa

DBGET integrated database retrieval system