KEGG   Rattus norvegicus (rat): 305719
Entry
305719            CDS       T01003                                 

Gene name
Fezf2
Definition
(RefSeq) fez family zinc finger protein 2
  KO
K24502  Fez family zinc finger protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    305719 (Fezf2)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    305719 (Fezf2)
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_jaz zf-Di19 zf-AN1 zf-BED zf-Sec23_Sec24
Other DBs
NCBI-GeneID: 305719
NCBI-ProteinID: NP_001100721
RGD: 1311068
Ensembl: ENSRNOG00000009206
UniProt: B4F7C0
Position
15
AA seq 455 aa
MASSASLETMVPPACPRAGASPATSKTLAFSIERIMAKTSEPRAPFEPRPAALEADSSQS
KKLLNLCSPLPCMIPLQPLGYEVPSKTLLSYSEFWKSSLRAGGGGGGGSGGGGPVCGASG
LCKTNCGVCCKAELGLAPSALPAGRVIKPQVINQAVGLPASGSLYYFNYLDSTTYPPSEL
LGGHLFPSGLLNAQAPTSLAAHPKLFLLENAKLASLTADKFPHPASYPHKERLHAPLEQV
LKENSALTAERGGVKSHSKLPGGSTDSKPKNFTCEVCGKVFNAHYNLTRHMPVHTGARPF
VCKVCGKGFRQASTLCRHKIIHTQEKPHKCNQCGKAFNRSSTLNTHIRIHAGYKPFVCEF
CGKGFHQKGNYKNHKLTHSGEKQYKCTICNKAFHQVYNLTFHMHTHNDKKPFTCATCGKG
FCRNFDLKKHVRKLHDSVGPTATPSAKGLARTVQS
NT seq 1368 nt   +upstreamnt  +downstreamnt
atggccagctcagcttccctggagaccatggtgcccccggcctgcccgcgcgctggagcg
tcaccggccacttcgaaaacactagctttctccatcgagcgcatcatggccaagacgtcc
gagccccgagcgccttttgagccccggcctgctgcgctagaggcagacagcagccagagc
aagaaactgctcaacctctgctcgccgctgccctgtatgatccccctccagcctctaggc
tacgaggtgccgtccaagacactgctcagttactcggagttctggaaaagcagcctccgg
gcgggcggcggtggaggaggaggcagcggcggggggggcccagtgtgcggcgccagtggc
ttgtgcaaaaccaactgtggcgtgtgctgcaaggccgaactgggccttgcgccttctgcg
ctgcccgccggcagggtcatcaagccgcaggtcatcaaccaggctgtggggctgccggcc
agcggctctctctactacttcaactacctggactccaccacttacccaccatcggagctc
ctcggaggccaccttttcccatctggcctcctcaacgcacaggcccccacttccctggct
gctcaccccaagctttttctgctggagaatgccaaactggccagcctgactgcggacaag
ttcccccacccagcttcctatccccataaggagcgcttgcatgcgccgctggagcaggtg
ctgaaggagaactcggccttgaccgctgaacgagggggagtcaagagccacagcaaacta
ccggggggctctactgacagcaaacccaaaaacttcacctgcgaagtgtgcggcaaggtg
ttcaatgctcactataacctcacccgccacatgcctgtccacaccggagctagaccgttt
gtgtgcaaagtctgtggcaaaggcttccgccaggccagcactctctgcagacacaaaatt
atccatacccaggaaaaaccacataagtgtaaccagtgcggcaaagccttcaatcgcagc
tccacgctcaatacgcacatccgcatccacgcgggctacaagcccttcgtctgcgagttt
tgcggcaagggctttcaccaaaaagggaactacaagaaccacaagctcacacacagcggc
gagaagcagtacaaatgcactatctgtaacaaggccttccaccaggtgtacaatctgacc
ttccacatgcacacccacaacgacaagaagcccttcacatgcgccacttgcggcaaaggt
ttttgcagaaactttgacttaaagaaacatgtgcgcaaacttcatgacagcgtgggtccc
accgccaccccctcagcaaagggcctagccaggacagttcagagctga

DBGET integrated database retrieval system