KEGG   Rattus norvegicus (rat): 305719
Entry
305719            CDS       T01003                                 

Gene name
Fezf2, Zfp312
Definition
(RefSeq) Fez family zinc finger 2
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_jaz zf-C2H2_6 zinc_ribbon_15 zf-Di19 zf-AN1 zf-Sec23_Sec24
Other DBs
NCBI-GeneID: 305719
NCBI-ProteinID: NP_001100721
RGD: 1311068
Ensembl: ENSRNOG00000009206
UniProt: B4F7C0
Position
15p16
AA seq 455 aa
MASSASLETMVPPACPRAGASPATSKTLAFSIERIMAKTSEPRAPFEPRPAALEADSSQS
KKLLNLCSPLPCMIPLQPLGYEVPSKTLLSYSEFWKSSLRAGGGGGGGSGGGGPVCGASG
LCKTNCGVCCKAELGLAPSALPAGRVIKPQVINQAVGLPASGSLYYFNYLDSTTYPPSEL
LGGHLFPSGLLNAQAPTSLAAHPKLFLLENAKLASLTADKFPHPASYPHKERLHAPLEQV
LKENSALTAERGGVKSHSKLPGGSTDSKPKNFTCEVCGKVFNAHYNLTRHMPVHTGARPF
VCKVCGKGFRQASTLCRHKIIHTQEKPHKCNQCGKAFNRSSTLNTHIRIHAGYKPFVCEF
CGKGFHQKGNYKNHKLTHSGEKQYKCTICNKAFHQVYNLTFHMHTHNDKKPFTCATCGKG
FCRNFDLKKHVRKLHDSVGPTATPSAKGLARTVQS
NT seq 1368 nt   +upstreamnt  +downstreamnt
atggccagctcagcttccctggagaccatggtgcccccggcctgcccgcgcgctggagcg
tcaccggccacttcgaaaacactagctttctccatcgagcgcatcatggccaagacgtcc
gagccccgagcgccttttgagccccggcctgctgcgctagaggcagacagcagccagagc
aagaaactgctcaacctctgctcgccgctgccctgtatgatccccctccagcctctaggc
tacgaggtgccgtccaagacactgctcagttactcggagttctggaaaagcagcctccgg
gcgggcggcggtggaggaggaggcagcggcggggggggcccagtgtgcggcgccagtggc
ttgtgcaaaaccaactgtggcgtgtgctgcaaggccgaactgggccttgcgccttctgcg
ctgcccgccggcagggtcatcaagccgcaggtcatcaaccaggctgtggggctgccggcc
agcggctctctctactacttcaactacctggactccaccacttacccaccatcggagctc
ctcggaggccaccttttcccatctggcctcctcaacgcacaggcccccacttccctggct
gctcaccccaagctttttctgctggagaatgccaaactggccagcctgactgcggacaag
ttcccccacccagcttcctatccccataaggagcgcttgcatgcgccgctggagcaggtg
ctgaaggagaactcggccttgaccgctgaacgagggggagtcaagagccacagcaaacta
ccggggggctctactgacagcaaacccaaaaacttcacctgcgaagtgtgcggcaaggtg
ttcaatgctcactataacctcacccgccacatgcctgtccacaccggagctagaccgttt
gtgtgcaaagtctgtggcaaaggcttccgccaggccagcactctctgcagacacaaaatt
atccatacccaggaaaaaccacataagtgtaaccagtgcggcaaagccttcaatcgcagc
tccacgctcaatacgcacatccgcatccacgcgggctacaagcccttcgtctgcgagttt
tgcggcaagggctttcaccaaaaagggaactacaagaaccacaagctcacacacagcggc
gagaagcagtacaaatgcactatctgtaacaaggccttccaccaggtgtacaatctgacc
ttccacatgcacacccacaacgacaagaagcccttcacatgcgccacttgcggcaaaggt
ttttgcagaaactttgacttaaagaaacatgtgcgcaaacttcatgacagcgtgggtccc
accgccaccccctcagcaaagggcctagccaggacagttcagagctga

DBGET integrated database retrieval system