KEGG   Rattus norvegicus (rat): 305848
Entry
305848            CDS       T01003                                 

Gene name
Zfp219, Znf219
Definition
(RefSeq) zinc finger protein 219
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-Di19 zf-H2C2_5 Zn-ribbon_8 Zn_Tnp_IS1595 DUF3268
Other DBs
NCBI-GeneID: 305848
NCBI-ProteinID: NP_001007682
RGD: 1359259
Ensembl: ENSRNOG00000011544
UniProt: Q66H48
Position
15p14
AA seq 726 aa
MEGSRPRILVGHLEPSPPAFDGELDLQRYSNGPGVSGTPGPGSPGMGAVGWSETRAGERR
FPCPVCGKRFRFNSILALHLRAHPGAQAFQCPHCGHRAAQRALLRSHLRTHQPERPRSPA
ARLLLELEERALLREARLGRARSSGGMQSSPAAEGLARPQVPSSSAFRCPFCKGKFRTSA
ERERHLHILHRPWKCSLCSFGSSQEEELLHHSLTAHGASERPLAATATPEPQPPPQQEPR
SALEPEPEPEPRPEPEREANPAPTPAPPEEPPAPPEFRCQVCGQSFTQSWFLKGHMRKHK
ASFDHACPVCGRCFKEPWFLKNHMKVHTSKLGPLRAPGPGSAPARAPQPPDLSLLAYEPL
GPALLLAPAPTPAERREPPSLLGYLSVRAGEVRPNGEGADPGGGRSYGGFRPLPSALPNR
ARRHRTEEPEEEEEVVEAEEESWARGRSLGSLTSLHPNPGEGSGQSAPAVGAQARSTATQ
EENGLLVGGTRSEAGRGATGKDCPFCGKSFRSAHHLKVHLRVHTGERPYKCPHCDYAGTQ
SGSLKYHLQRHHREQRSSAGPGPPPEPPPPSQRGSLQPQSGAKPTQASATWVEGTASTRP
TSSSTGPGSRRKPASPGRTLRNGRGGEAEPLDLSLRAGPGGEAGSGGALHRCLFCPFATG
APELMALHLQVHHSRRARGRRQPRADTSPPYVRAPSGETPPSPPLEEEGSPGLSRSGEAG
LGGQER
NT seq 2181 nt   +upstreamnt  +downstreamnt
atggagggctcacgtccccgcatcctggtcggccacctagagccttccccaccagccttc
gacggcgagctggatcttcagcgctactccaacggaccaggtgtcagcgggaccccagga
cccggctctcctgggatgggagcagtgggctggtctgagactcgtgcaggcgaacggcgc
ttcccctgtcctgtgtgcggaaagcgcttccgattcaattctatcctggcattgcacctg
agagcccatccgggcgcccaagccttccagtgcccacattgcggccaccgcgcagctcag
cgggccctgctacgctctcatctccgaacgcaccagccggagcgtccacgcagtcctgct
gcacggctgttgctggagttggaggaacgcgccctgcttcgtgaagcccgactcgggaga
gccagaagctcagggggcatgcagtccagccctgccgcagagggcctggcgcgccctcag
gttccttcctcatctgccttccgttgtcctttctgcaaaggcaagtttcgcacctcggcg
gagcgggaacgccacctgcatatcctgcacaggccctggaagtgcagcttgtgcagtttt
ggctccagccaggaggaggagttgctgcaccacagtctgacggcccacggggcttccgag
cgccccctggcggctactgctacacctgaaccccagcctccaccccagcaagaacccaga
tctgcccttgagcctgagcctgagcctgaacctaggccagagcctgaacgtgaggcaaac
cctgccccaactcctgcgcctccggaggagccccccgcgccacctgagttccgttgccag
gtgtgtggccagagctttacacagtcctggtttctcaagggtcacatgcgcaagcacaag
gcctcctttgatcatgcgtgccccgtatgtggtcgctgcttcaaggagccctggttcctt
aagaaccacatgaaggtgcacaccagcaagctgggtcctttgcgtgctccaggccccggc
tctgcgcctgccagggcccctcagcctcctgacctgagccttctggcttatgagccactg
ggtcctgcgctcctcctggccccagcacccactccggctgagcgccgagagcccccgagc
ctcttaggctacctgagtgtacgagctggggaagtacgacccaatggtgagggtgctgac
cctggaggtggccgaagctatggaggattccgcccactgccttcagctctgcccaaccgg
gcccggcgacaccgtacagaggaaccagaggaggaagaagaagtggtggaagcggaagag
gagagctgggcccgaggcaggtcactgggctctctgacttccctacatcccaacccgggt
gaggggtcaggacagtctgcacctgctgtgggggcccaggcaagatctacggccacccaa
gaagaaaacgggctgctggttggagggacacgatctgaagcgggccgtggggccactggc
aaggactgccccttctgtgggaaatctttccgctcggcgcatcacctcaaagtgcatctt
cgcgtgcacacaggagagcgtccctacaagtgtccacactgcgactatgcaggtacccag
tcgggctcgctcaagtatcaccttcagcgtcaccaccgtgagcagaggagcagtgcgggt
cctgggcctcccccagagcccccgccaccttcccagcggggctcactgcagccgcagtca
ggagccaagcccactcaggcctctgctacctgggtagagggcactgcaagtacccggcct
acttcgagcagcaccggaccagggtcccgcaggaagcctgccagccctgggaggaccctg
cgcaacgggcgaggtggtgaggccgaacccctggacctgtccctacgggcaggcccggga
ggtgaggccgggtcagggggtgcccttcaccgctgcctcttctgcccctttgccactgga
gctcctgagctcatggccttgcatctgcaagtacaccacagccgtcgtgcacggggccgc
cggcagccccgtgctgacacatctccaccctatgtccgggcaccgtcaggggagacccct
cccagtcctccactagaagaggagggcagcccagggctgtctagatccggagaggcaggt
cttgggggtcaagaacggtag

DBGET integrated database retrieval system