KEGG   Rattus norvegicus (rat): 306247
Entry
306247            CDS       T01003                                 

Gene name
Il17rb
Definition
(RefSeq) interleukin-17 receptor B
  KO
K05165  interleukin 17 receptor B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    306247 (Il17rb)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    306247 (Il17rb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rno04050]
    306247 (Il17rb)
Cytokine receptors [BR:rno04050]
 Interleukin receptor families
  IL17 receptor family
   306247 (Il17rb)
SSDB
Motif
Pfam: SEFIR IL17R_fnIII_D2 A2M_BRD
Other DBs
NCBI-GeneID: 306247
NCBI-ProteinID: NP_001100760
RGD: 1311392
Ensembl: ENSRNOG00000015498
UniProt: B5DF15
Position
16
AA seq 354 aa
MNEDSPSLSVNFTSPGCLNHVMKYKKQCIEAGSLWDPNITACKKNEKTVEVNFTTNSLGN
RYMVLIRRDTMLGVSIVLENKLTRTSVVIPVNDESEGALVELTPYLHTCDNDCIRRKGTV
VLCSETSAPFPPDDNRSMLRGWLPLLLVLLVATWVLAVGIYLTWRQGRSTKTSFPITAML
LPLVKVLVVYPSEICFHHTVCRFTDFLQNYCRSEVILEKWQKKKIAEMGPVQWLTTQKQA
ADKVVFLLPSDAPSLCDSACGHKEGSATENSQDLFPLAFNLFCSDFSSQTHLHKYLVVYL
GGADLKGDYNALRVCPQYHLMKDAPAFHTELLKATQSMPLKKRPQACHGSCSPL
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgaacgaggacagcccttctttgtctgtgaacttcacctcgccaggctgcctaaaccat
gtaatgaaatataagaagcagtgcattgaagcaggaagcctgtgggacccaaacatcaca
gcttgtaagaagaatgagaagaccgttgaagtgaattttacaaccaattcccttggaaac
agatacatggttctcattcgacgggacacaatgttgggggtttctatagtgctggagaac
aaactgacgaggacatctgtagtcattccggtcaatgatgagagtgaaggtgccttggtt
gagctgaccccatatttacacacctgcgacaatgactgcattcgacgcaaagggacagtg
gtgctttgctcagagacaagtgctcccttccctccagatgacaacagaagcatgctgaga
ggctggctgcctctcctcctggtgctgctggtggctacatgggtgctggcagttgggatc
tacctaacttggaggcaaggaaggagcacaaagacatcttttcctatcaccgccatgctc
ctgcccctcgttaaggtcctggtggtttacccatccgagatatgtttccatcacacagtc
tgtcgctttactgactttcttcaaaactactgcagaagtgaggtcatccttgaaaaatgg
cagaaaaagaaaatcgccgagatggggcccgtgcagtggcttaccactcagaagcaagca
gcagataaagtcgtcttccttcttcccagtgacgccccttccctttgtgacagtgcctgt
ggccacaaggagggcagtgccacggagaattctcaggatctgttccctcttgcctttaac
ctcttttgtagcgatttcagcagccagactcatctgcacaaatacctggtggtctatctt
gggggagcagacctcaaaggggactataatgccctgagagtctgcccccagtatcatctc
atgaaggacgccccagctttccacacagaacttctcaaggctacgcaaagcatgccgctg
aagaaacggccacaggcctgccacggcagctgttcacccttgtag

DBGET integrated database retrieval system