KEGG   Rattus norvegicus (rat): 306330
Entry
306330            CDS       T01003                                 

Gene name
Klf2
Definition
(RefSeq) Krueppel-like factor 2
  KO
K17845  krueppel-like factor 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04068  FoxO signaling pathway
rno04371  Apelin signaling pathway
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    306330 (Klf2)
   04068 FoxO signaling pathway
    306330 (Klf2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    306330 (Klf2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    306330 (Klf2)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    306330 (Klf2)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_8
Other DBs
NCBI-GeneID: 306330
NCBI-ProteinID: NP_001007685
RGD: 1359220
Ensembl: ENSRNOG00000014205
UniProt: Q9ET58
Position
16
AA seq 351 aa
MALSEPILPSFATFASPCERGLQERWPRNEPEAGSTDEDLNSVLDFILSMGLDGLGAENP
PEPPPQPPPPAFYYPEPGAPPPYGTPAAGLGTELLRPDLDAPQGPALHGRFLLAPPGRLV
KAEPPEVDGGGYGCAAGLARGPRGLKLEGALGATGACMRGPAGRPPPPSDTPPLSPDGPP
RLPAPGPRNPFPPPFGPGPSFGGPGPALHYGPPAPGAFGLFDDAAAALGLAPPATRGLLT
PPSSPLELLEAKPKRGRRSWPRKRAATHTCSYTNCGKTYTKSSHLKAHLRTHTGEKPYHC
NWDGCGWKFARSDELTRHYRKHTGHRPFQCHLCDRAFSRSDHLALHMKRHM
NT seq 1056 nt   +upstreamnt  +downstreamnt
atggcgctcagcgagcctatcttgccgtcctttgccactttcgccagcccctgcgagcgc
ggcctccaggagcgctggccgcgaaatgagcccgaggcgggcagcacggatgaggaccta
aacagcgtgctggacttcatcctgtccatgggactggacggcctgggcgccgagaaccct
cccgagcccccaccgcagcccccgcctcctgcgttctactacccggagccgggtgcccct
ccgccctatggcaccccggcggctggcctgggaacggagctgctgcgcccggatctggat
gcgcctcaggggccggctctacacggccgcttcctcctcgcgcctcccgggcggctggtg
aaagccgagcccccggaggtggacggcggcggctacgggtgcgcagccggcttggctcgc
ggaccgcgcgggctgaagctcgagggcgccctgggagcgacaggtgcatgcatgcggggt
cctgctggccgtcccccaccgccctccgacacgccgccgctcagccccgacggccccccg
cgcctcccggcgcccggtccccgcaacccgttcccgccacccttcggccccggccccagc
ttcggcggccccggccccgcgttgcactacgggccgcccgctcccggcgctttcggtctc
ttcgacgacgcggcggcggctctgggtcttgctccccctgccacgcgcggtctcctcacg
ccgccctcgtccccgctggagctgttggaggccaagcccaagcgcggccgccgctcctgg
ccccgcaagcgcgccgccacgcacacttgcagctacaccaactgcggcaagacctacacc
aagagttcgcacctaaaggcgcatctgaggacgcacacaggtgagaagccttatcattgc
aactgggacggctgcggctggaagttcgcgcgctctgacgagcttacccgccactaccgc
aagcacacgggtcacaggcccttccagtgccacttgtgcgaccgggccttctccaggtcc
gaccacctggctctgcacatgaagcgacacatgtag

DBGET integrated database retrieval system