KEGG   Rattus norvegicus (rat): 306353
Entry
306353            CDS       T01003                                 

Gene name
Rfxank
Definition
(RefSeq) regulatory factor X-associated ankyrin-containing protein
  KO
K08062  regulatory factor X-associated ankyrin-containing protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04612  Antigen processing and presentation
rno05152  Tuberculosis
rno05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    306353 (Rfxank)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    306353 (Rfxank)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    306353 (Rfxank)
SSDB
Motif
Pfam: Ank_2 Ank_5 Ank_3 Ank_4 Ank
Other DBs
NCBI-GeneID: 306353
NCBI-ProteinID: NP_001013154
RGD: 1311390
Ensembl: ENSRNOG00000033318
UniProt: Q5PQM6
Position
16p14
AA seq 284 aa
MEPTQVAENLIPNQQSLAPDLEDPEDRRDESPDSSDTVVLSLFPCTPDAVNPEADASASS
LQVPAASVWTPLAQAQTPGEQALPLLAGSFLKHSTTLTNRQRGNEVSALPATLDSLSIHQ
LAAQGELSQLKDHLRKGDNLVNKPDERGFTPLIWASAFGEIETVRFLLDWGADPHILAKE
RESALSLASMGGYTDIVRLLLDRDVDINIYDWNGGTPLLYAVRGNHVKCVEALLARGADL
TTEADSGYTPMDLAVALGYRKVQQVMESHILKLFQGTLGPADPE
NT seq 855 nt   +upstreamnt  +downstreamnt
atggagcccactcaggttgcagagaacctcatcccaaaccagcagtcccttgctcctgac
ctagaggatcctgaggaccgcagagatgaatccccagatagctctgacactgtcgtcctc
agtctgttcccctgcaccccagacgctgtgaatcctgaggcagatgccagtgcatcctca
ctacaggttcctgcagcatctgtctggacacccttggcacaagcccaaacaccaggggaa
caagcccttcctctcctcgcaggaagtttcttgaagcactccacaaccctcacaaaccgg
caacgtgggaatgaggtctcagctctgccagccaccctggactccctgtctatccaccag
cttgcagcccagggggagctgagtcaactgaaggatcacctgcgaaagggtgacaacctg
gtcaacaagccggatgaacgtggcttcacccccctcatctgggcctcagcctttggagaa
attgagacagtacgcttcctgctagactggggtgctgacccccacatcctggccaaggag
cgggaaagcgctctgtcgcttgccagtatgggtggttacacggacatcgtgaggttgctg
cttgaccgtgatgtggacatcaacatctatgactggaatggggggacaccactgctctac
gctgtgcgtgggaaccatgtgaagtgtgtggaggccttactcgcccgaggtgctgacctc
accacagaggccgactctggctacaccccaatggacctcgccgtggccctaggataccgc
aaagtgcaacaggtgatggagagccacatcctcaaactgttccagggtaccctggggcct
gcggacccggagtga

DBGET integrated database retrieval system