KEGG   Rattus norvegicus (rat): 306570
Entry
306570            CDS       T01003                                 

Gene name
Ank1
Definition
(RefSeq) ankyrin 1
  KO
K10380  ankyrin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    306570 (Ank1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    306570 (Ank1)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filament-binding proteins
    306570 (Ank1)
SSDB
Motif
Pfam: Ank_2 Ank_4 Ank Ank_3 Ank_5 UPA_2 ZU5
Other DBs
NCBI-GeneID: 306570
NCBI-ProteinID: NP_001100792
RGD: 1309620
Ensembl: ENSRNOG00000018241
UniProt: D3Z9Z0
Position
16q12.5
AA seq 1707 aa
MAERPRRSGSDPAADAATSFLRAARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEG
HVKMVVELLHKEIILETTTKVRDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIA
ARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGI
TPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQA
KTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDK
GAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTEKVETPLHMAARAGHTEVA
KYLLQNKAKANAKAKDDQTPLHCAARIGHTSMVKLLLENDASPNLATTAGHTPLHTAARE
GHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPL
HVAVHHNNLDIVQLLLPRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAESV
QGVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVT
VDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLL
LKNGASPNEVSSNGTTPLAIAKRLGYISVTDVLKVVTDETSVVLVSDKHRMSYPETVDEI
LDVSEDEGTAHISLTGDELVGSKAERRDSRDVGEEKELLDFVPKLDQVVESPAIPRIPCV
TPETVVIRSEDQEQASKEYDEDSLIPSSPATETSDNISPVASPVHTGFLVSFMVDARGGS
MRGSRHNGLRVVIPPRTCAAPTRITCRLVKPQKLSTPPPLAEEEGLASRIIALGPTGAQF
LSPVIVEIPHFASHGRGDRELVVLRSENGSVWKEHKSRYGESYLDQILNGMDEELGSLEE
LEKKRVCRIITTDFPLYFVIMSRLCQDYDTIGPEGGSLRSKLVPLVQATFPENAVTKKVK
LALQAQPVPDELVTKLLGNQATFSPIVTVEPRRRKFHRPIGLRIPLPPSWTDNPRDSGEG
DTTSLRLLCSVIGGTDQAQWEDITGTTKLVYANECANFTTNVSARFWLSDCPRTAEAVHF
ATLLYKELTAVPYMAKFVIFAKMNDPREGRLRCYCMTDDKVDKTLEQHENFVEVARSRDI
EVLEGMPLFAELSGNLVPVKKAAQQRSFHFQSFRENRLAIPVKVRDSSREPGGFLSFLRK
PMKYEDAQHILCHLNVTMPPCTKGSGAEDRRRTLTPLTLRYSILSESRLGFTSDTDRVEM
KMAVIREHLGLSWAVENLYTALRNIDRSEIVNMLEGSGRQSRNLKPDRRHGDREYSLSPS
QVNGYSSLQDELLSPASLHYALPSPLCADQYWNEVAVIDAIPLAATEHDTMLEMSDMQVW
SSGLTPSLVTAEDSSLECSKAEDSDAIPEWKLEGAHSEDTQGPELGSQDLVEDDTVDSDA
TNGLADLLGQQRVHARITDSPSVRQVLDRSQARTVDWYKQGSAASYPQEAAQSSWQEEVT
QGPQSFQRRITTIQGPEPGTLQEYEQVVVSTREHVQRGPPESDSPKAGKDPSLWASESAF
SQEVQGDELQNIPGEQVTEEQFTDEQGNIVTKKIIRKVVRQVDSSGAIDTQQHEEVELRG
SGLQPDLIEGRKGAQIVKRASLKRGKQ
NT seq 5124 nt   +upstreamnt  +downstreamnt
atggcagaacggccgcgcaggtcggggtcagaccccgcggccgatgctgctaccagcttt
ttgcgggcggcacgctcaggaaacctggacaaggctttggatcacctacgcaatggagtg
gacattaacacctgtaaccagaacgggttgaatggcttgcatctggcctccaaagaaggc
catgtgaagatggtggttgaacttctgcacaaagagatcattctagaaacaacaaccaag
gtaagggatggcttcactccgctggctgtggctctgcagcagggccatgagaatgtggtg
gctcacctcatcaactatggaacgaaaggaaaagtgcgcctccctgccctgcacatcgcg
gcccgcaacgatgacacacggacagccgcagtccttctgcagaatgaccccaacccagat
gtgctttccaagacgggattcacacccctccacatcgcagcacactacgagaacctcaac
gtggcccagctgctcctcaaccggggagccagcgtcaacttcacacctcagaatggtatt
actccactgcacatcgcctcccgcaggggaaatgtgatcatggtgagactcctgctggac
cgaggggctcagatagaaacgaggaccaaggatgaactgacaccactccactgtgcagct
cggaatggacacgtgagaatctcagagatcctgctggaccacggggcacccatccaagcc
aaaaccaagaatggcttgtcccccatccacatggcggctcagggagaccacctcgactgt
gtccgacttctattgcaatacaacgccgagatagatgacatcaccttagatcacctgact
cctctccacgtggcagcccactgcggccaccacagggtggctaaggttcttttggataaa
ggggccaagccgaactccagagccctgaatggctttaccccactacacatcgcctgcaag
aagaaccacatacgtgtcatggagctgctgctgaagacaggagcctctattgacgcagtc
actgagaaagtagaaaccccattgcacatggcagcccgagcagggcatacagaagtggcc
aaatatttgctccagaacaaagccaaagccaatgccaaggccaaggacgaccagacacca
cttcactgtgctgctcgcatcggccacacgagcatggtgaagctcctgctggagaatgac
gccagccccaacctggctaccactgctggccacacacctctgcacaccgcagcccgtgag
ggtcacgtggacacagccctggccctgctggaaaaggaggcatcccaagcctgcatgacc
aagaaaggatttacccctctccacgtggctgccaagtatgggaaggtccggctggcagag
ctgctgctggaacatgatgcccatcccaacgcggccggaaagaacggcttgactcccctg
catgtggccgtccatcacaacaacttggacattgtccagcttctccttccccgaggtggc
tccccgcacagccctgcctggaatggctacacccctttgcacatcgcagccaagcagaac
cagatagaggtggcccgcagtctactgcaatacggagggtccgcgaatgcagagtctgta
caaggagtgaccccgcttcacctggctgcccaagagggccacacggaaatggtcgctctt
ctcctgtcaaagcaagccaatggcaacctggggaacaagagtggactcactcctctccac
ctggtagcacaagaaggccatgttccagtggcggatgtgctgattaaacatggcgtcaca
gtggatgctacgacccggatgggttacaccccactccacgtggccagtcactacggaaac
atcaagctggtgaagttcctgctacagcaccaggcagatgtcaacgccaagaccaagcta
gggtacagccccttgcaccaggcagctcagcaaggacacacggacattgtgacattgctc
ctgaagaatggtgcttctccaaatgaggtcagctcgaacggaaccacacctctggcaata
gccaaacgtttgggctacatctctgtaacagacgtgctcaaggtggtcacagatgaaacc
agtgtggtgttagtcagtgacaaacaccggatgagctaccctgagacagtggatgagatc
ctggatgtgtctgaagatgaaggaactgctcacatatctttaacgggtgacgaacttgtc
ggctcgaaggctgaaaggcgggactcccgggatgtgggtgaggagaaagagctgttggat
tttgtgccgaagctagaccaagtggtggaatccccagccatcccaaggatcccttgtgtc
acgcctgagactgttgtgatccgatccgaagatcaggaacaagcatctaaagagtatgat
gaggactcactcattcccagtagcccagccacagagacctcagacaacatcagccccgtg
gctagccccgtccacacagggtttctggtgagcttcatggtcgatgcccggggaggatcc
atgagaggaagtcgtcataatggcctaagggtggtgatccctccccggacatgcgcagca
cccactcgcatcacctgccgcctggttaagccccagaagctaagcacaccgcccccgctg
gctgaggaggagggcctagccagcaggatcattgcactgggtcctacgggggcccagttc
cttagccctgtgatcgtggaaatcccccactttgcctcccatggccgcggggaccgtgag
ctggtggttctgaggagcgagaacggctccgtgtggaaggagcacaagagccgctatgga
gaaagctacctggaccagatcctgaacggcatggacgaagagctggggagcctggaggag
ctggagaagaagcgcgtgtgtcgcatcattaccaccgacttccccctgtactttgtcatc
atgtcccggctctgccaggactacgacaccatcggtcctgaagggggctccctgagaagc
aagctggtgcccctggtacaggcgacgttccccgaaaacgcggtgaccaagaaagtgaag
ctggctctgcaggcccagcctgtcccagacgagctggtgaccaagctcctgggcaaccag
gccaccttcagccccattgttactgttgagccaaggcgtcggaagttccaccgtcccatt
gggctgcgaatcccactccctccctcatggactgacaaccccagggacagcggggaggga
gacaccaccagcctacgcttactgtgcagcgtcatcggtggaactgaccaagcccagtgg
gaagatataacgggaacaaccaagcttgtatacgccaatgagtgcgccaactttaccacc
aacgtctcagccagattctggctgtcggactgtcctcggaccgctgaggccgtacacttt
gccactctcttgtacaaagagctcacggcagttccctacatggccaagtttgtcattttc
gccaagatgaacgacccccgggaaggacggctacgctgctactgcatgacagatgacaag
gtggacaagaccctggaacagcatgaaaacttcgtggaggtggcccggagcagggacata
gaggttctagaagggatgcctctgtttgcagaactctctgggaacttggtgcctgtcaag
aaagcggcccagcagcgaagcttccatttccagtcatttcgagagaatcgcctggccatc
cccgtgaaggtgagggacagcagccgcgagccaggagggttcttgtcgttcctgcggaag
ccgatgaaatatgaagacgcacagcacatcctctgccacttgaatgtcaccatgcccccc
tgtaccaagggcagtggagcagaagacaggagaaggaccctgacgcccttgactcttcgc
tatagcattctcagcgagtcccggctgggttttaccagtgacacagaccgtgttgaaatg
aagatggctgtcatcagggagcacctcggcctcagctgggcagtggagaatctgtacacg
gccctgcggaacatcgacagaagtgagattgttaacatgttggagggctccggcaggcag
agcagaaacctcaaaccagaccggaggcatggggaccgggagtactcattgtcaccctcc
caggtgaatggttactcctcgctgcaggacgagctgctgtcccccgcctccctgcactac
gcacttccctctccactgtgtgcagaccagtactggaacgaagtggccgtcatagacgcc
atccccctggcggccacggagcatgacaccatgctggagatgtctgacatgcaggtgtgg
tcttcgggcctcacaccctccctggtcactgctgaggactcctctctggagtgcagcaag
gccgaggactctgacgccataccagagtggaagttggagggggcacactcagaggacacg
cagggcccggagctgggctctcaggacctggtggaggacgacacagtggattcagatgcc
acaaatggcctggcagatttgctaggccagcagcgagttcacgcccgaatcacagactca
ccctcagtgaggcaggtgctggacagaagccaggccagaacagtggactggtataaacag
ggttcagcagcatcatatccacaagaggccgcacaaagttcctggcaagaggaggtcacg
caaggcccacagtcattccagagaaggatcaccaccatccaagggccggagcccggcaca
cttcaggaatatgagcaggtggtggtgtccaccagggagcatgtgcagagggggccacct
gagagcgacagccccaaggccgggaaggacccaagtctgtgggcatcggagagtgccttc
tctcaagaggtgcagggggatgagcttcagaatattccaggagagcaggtgacagaggaa
caattcacagacgaacagggcaacattgtcaccaagaagatcattcgaaaagtcgtccga
caggtggactcctctggtgccatcgacacccagcagcacgaggaggtggagctaagaggg
agtggactccagccggacctgatagaaggcaggaagggggctcaaatagtgaagcgggcc
agcttgaaaaggggcaaacagtga

DBGET integrated database retrieval system