KEGG   Rattus norvegicus (rat): 307035Help
Entry
307035            CDS       T01003                                 

Gene name
Mpp7
Definition
(RefSeq) membrane palmitoylated protein 7
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_kin L27 PDZ PDZ_6 SH3_2 SH3_1 PDZ_2 SH3_9
Motif
Other DBs
NCBI-GeneID: 307035
NCBI-ProteinID: NP_001094045
RGD: 1305675
Ensembl: ENSRNOG00000018760
UniProt: Q5U2Y3
Position
17q12.1
AA seq 576 aa AA seqDB search
MPALATGSACDTGLYELLAALPAQLQPHVDSQEDLTFLWDMFGEKSLHSLVKIHEKLHYY
EKQSPVPILHGAAALADDLADELQNKPPNSEIRELLKLLSKPNVKALLSVHDTVAQKSYD
PVLPPMPDDIDDEEDSVKIIRLVKNREPLGATIKKDEQTGAITVARIMRGGAADRSGLIH
VGDELREVNGIPVEDKRPEEIIQILSQSQGAITFKIIPSTKEEIPSKEGKIFIKALFDYD
PKEDKAIPCKEAGLSFRKGDILQIMSQDDATWWQAKHEGDTNPRAGLIPSKHFQERRLAL
RRPEIVVQPLKLSNRKSSGFRRSFRLSRKDKKTNKSMYECKKSEQYDTADVPTYEEVTPY
RRQTHDKYRLVVLVGPVGVGLNELKRKLLMSDTQHYGVTVPHTTRARRSQESDGVEYIFI
SKHLFETDVQNNKFIEYGEYKNNYYGTSIDSVRSVLAKNKVCLLDVQPHTVKHLRTLEFK
PYVIFIKPPSIERLRETRKNAKIISSRDDQGTAKPFTEEDFQEMIKSAQIMESQYGHLFD
KIIINDDLTVAFNELKTTFDKLETDAHWVPVSWLHS
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgccagcactggccacaggatctgcctgcgacacgggtctgtacgagctgttggctgct
ctgcctgcccagctgcagccacatgtggatagccaggaggacctgaccttcctctgggac
atgtttggtgaaaaaagcctgcattcactggtcaagatccatgagaaacttcactactat
gagaagcagagtccagtgcccattctccatggcgcggcagctttggctgatgacctggct
gacgagctccagaacaagccaccaaacagtgagatcagagagctgttgaaactgctgtcc
aaacccaatgtgaaggctttgctgtcagtgcatgatactgtggctcaaaagagttacgat
cctgtattgcctcccatgcctgacgatattgatgacgaggaagactctgtgaaaatcatc
cgcctggttaagaacagagagcctctgggtgctactattaaaaaagatgaacagaccgga
gcaatcaccgtggcccgaatcatgcggggaggagctgcagatagaagtggtcttattcat
gtgggcgatgagctaagggaagtgaatgggatcccagtggaagataagaggcccgaggaa
ataatacagattttgagtcagtcccagggagcaattacatttaagataatacccagcacc
aaagaggagataccttctaaagagggcaagatatttatcaaagccctctttgactatgat
cctaaggaggacaaggcgatcccatgtaaagaggcaggcctgtctttcaggaagggtgac
attcttcagattatgagccaagatgatgcgacatggtggcaggctaagcatgaaggtgac
accaaccccagagcgggcctgattccctcgaagcacttccaggaacggagactggctctg
agacgaccagaaatagtagttcagcctctgaaactttccaacaggaaatcatctggtttt
agaagaagtttccgtcttagcagaaaggataagaaaacaaataagtccatgtacgaatgc
aaaaagagtgaacagtacgacacagcagatgtgcccacatatgaggaggtgacaccctac
cggcggcagacccatgacaagtacagactcgtcgtcctggttggtcctgttggagttggg
ctgaatgagctgaagcggaagctattgatgagtgacacacagcactatggcgtgacagta
cctcataccactagagcaagaagaagccaagagagtgatggcgtcgaatatatttttatt
tccaaacatttgtttgagacagatgtacaaaataacaagttcatcgagtacggcgaatat
aaaaacaactactatggtacgagcatagactcagtccgctctgtcctagctaagaacaaa
gtctgtctgttggatgtccagcctcatacagtgaagcatttaaggactctggagttcaaa
ccctatgtgatatttataaagcctccatccatagagcgtttgagagagacaagaaaaaat
gcaaagattatttcaagcagagatgaccaagggactgcaaagcccttcacggaagaagac
tttcaagaaatgatcaaatcagcacagataatggaaagtcaatatggccatctttttgac
aaaatcataataaacgatgatcttactgtagcatttaatgagctaaaaacaacatttgac
aaactagagactgatgcccattgggtcccagtgagctggttacattcttaa

DBGET integrated database retrieval system