KEGG   Rattus norvegicus (rat): 307271
Entry
307271            CDS       T01003                                 

Gene name
Mex3c, Rkhd2
Definition
(RefSeq) mex-3 RNA binding family member C
  KO
K15686  RNA-binding protein MEX3 [EC:2.3.2.27]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    307271 (Mex3c)
   04121 Ubiquitin system [BR:rno04121]
    307271 (Mex3c)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     307271 (Mex3c)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     307271 (Mex3c)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    307271 (Mex3c)
SSDB
Motif
Pfam: KH_1 zf-C3HC4_3 zf-C3HC4 Prok-RING_4 KH_2 zf-RING_5 zf-RING_UBOX
Other DBs
NCBI-GeneID: 307271
NCBI-ProteinID: NP_001100847
RGD: 1309023
Ensembl: ENSRNOG00000015777
UniProt: D4A2R5
Position
18q12.2
AA seq 464 aa
MMAAMLSHAYGPGGGGAAAAALNGEQAALLRRKSVNTTECVPVPSSEHVAEIVGRQGCKI
KALRAKTNTYIKTPVRGEEPIFVVTGRKEDVAMAKREILSAAEHFSMIRASRNKNGPALG
GLSCSPNLPGQTTVQVRVPYRVVGLVVGPKGATIKRIQQQTHTYIVTPSRDKEPVFEVTG
MPENVDRAREEIEMHIAMRTGNYIELNEENDFHYNGTDVSFEGGTLGSAWLSSNPVPPSR
ARMMSNYRNDSSSSLGSGSTDSYFGSNRLADFSPTSPFSTGNFWFGDTLPSVGSEDLAVD
SPAFDSLPTSAQTIWTPFEPVNPLSGFGSDPSGNMKTQRRGSQPSTPRLSPTFPESIEHP
LARRVRSDPPSTGNHVGLPIYIPAFSNGTNSYSSSNGGSTSSSPPESRRKHDCVICFENE
VIAALVPCGHNLFCMECANKICEKRTPSCPVCQTAVTQAIQIHS
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgatggcggcgatgctgtcccacgcctacggccccggcggcggcggggccgccgctgcc
gccctgaacggagagcaagcggccctgctgagaaggaagagcgtcaacaccaccgagtgc
gtcccggtgcccagttccgaacatgtcgctgagattgtcggacgccagggttgtaaaatt
aaagcactgagagccaagacaaacacgtatatcaagacacctgtccgcggtgaagagccc
atttttgttgtcactggacggaaagaagatgttgccatggccaagagagaaatcctttcg
gctgcagagcacttctctatgatccgtgcatctcggaacaaaaatggccccgcgcttgga
gggttatcgtgtagtcctaatctgcccggtcaaaccacagtccaagtcagggtcccctat
cgtgtggtagggctagtggttggaccaaaaggagcaacaattaagagaattcagcaacag
acccacacatacatagttactccgagcagagataaggagccagtctttgaagtcacaggg
atgccggaaaatgttgatcgagcacgagaagaaatagaaatgcatattgccatgcgtaca
gggaactatatagagctcaatgaagaaaatgatttccactataacggtaccgatgtgagc
tttgaaggtggcactctaggctctgcgtggctctcttccaatccagttcctccaagccga
gcaagaatgatgtccaactatcgaaatgatagttctagttctctaggaagtggttccact
gattcctattttggaagcaataggctggctgactttagtccaacaagcccgtttagcaca
ggaaacttttggtttggagatacactaccgtctgtaggctcagaagaccttgcagtagac
tctcctgcctttgactctttaccaacatctgctcaaactatctggactccatttgaacca
gttaacccactctctggctttgggagtgatccttctggtaacatgaagactcagcgtaga
ggaagtcagccatcaactcctcgtctgtctcctacctttcctgagagcatagaacaccca
cttgctcgaagggttaggagcgacccacctagtacaggcaaccatgttggccttccaata
tacatccctgctttttctaatggtaccaatagttattcctcttccaatggtggttccacc
tctagctcacctccagaatcaagaagaaagcacgactgtgtgatttgctttgagaatgaa
gttattgctgccctagttccatgtggccacaacctcttctgcatggaatgtgccaacaag
atctgtgaaaagagaacgccatcatgtccagtttgccagacagctgttactcaggcaatc
caaattcactcttaa

DBGET integrated database retrieval system