KEGG   Rattus norvegicus (rat): 307414
Entry
307414            CDS       T01003                                 

Gene name
MGC108823, Ifgga3
Definition
(RefSeq) similar to interferon-inducible GTPase
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: IIGP MMR_HSR1 Dynamin_N ABC_tran AAA_16 RsgA_GTPase AAA_29 KAP_NTPase Roc Septin AAA_22 Sigma54_activat AAA_23 PRK FeoB_N MeaB FtsK_SpoIIIE T2SSE
Other DBs
NCBI-GeneID: 307414
NCBI-ProteinID: NP_001012353
RGD: 1359421
Ensembl: ENSRNOG00000019542
UniProt: Q5FVQ6
Position
18q12.1
AA seq 417 aa
MGQWFSSKNEQHQDLASSFKEYFKKFKTGHKIISEEIITSVELSMTKGNIQMANSTISEA
LRDIDGTPLNVAVTGESGAGKSSFINALRGIGHEEEGAAEIGVVETTAERWPYKHPSMPN
VVIWDLPGIGTTNFPPKTYLEKMKFYEYDFFIIISATRFKKTDTDLAKAISMMKKDFYFV
RTKVDSDLRNEENTKPRSFDREKVLQNIRLNCVKHFKENGMDEPPIFLISNIDLSDYDFP
ILMDKLISDLPVYKRHTFMLSLPNITDSTIEMKRQCLKQRIWLEAFAADLLRILPSLTFL
LDSDLETLKKCLKFYRTVFGVDDAALQSLAKDWQMPLVELEAMMKSPIVFKPTDEETIHE
RLSRYYHDYCSANGHLFTDDRDLREISYLKYYFLDIVTEDAKTLLKEICVRNKLVSN
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgggtcaatggttctcttcgaagaatgaacagcaccaagatttggcctccagttttaaa
gaatattttaagaaatttaagacgggacacaaaatcatttctgaggaaatcatcacttca
gttgaattaagcatgacaaaagggaacattcaaatggcaaactctacaatcagtgaggca
ttaagagatatcgatggtacaccgctcaatgttgctgtcaccggggagtctggagcagga
aagtccagcttcatcaatgccctgagaggcattgggcatgaagaggaaggtgcagctgaa
attggggtggtggagacaaccgcggagagatggccgtacaaacaccccagtatgcctaat
gtggtcatttgggacctgcctgggattggaaccacaaattttccaccaaaaacgtatcta
gaaaagatgaaattctatgaatatgacttcttcattattatttcagccacccgctttaag
aaaactgatacagacctcgccaaagcaatcagtatgatgaagaaggatttctactttgtg
agaaccaaggtggactctgacttacgaaatgaagagaacaccaaaccacgatcctttgac
agagaaaaagtactgcagaacatccgccttaactgtgtgaaacacttcaaggagaatggc
atggatgagccaccaatcttcttgatctctaacatagatctttctgactatgatttccca
atcctgatggacaagctgataagtgatctccctgtatacaagcgacacactttcatgctc
tccttacccaatattacagattcaaccattgaaatgaagagacaatgtttgaagcagagg
atttggctcgaagcctttgcagctgacctactgagaatcctcccttcactgaccttcctc
ttggacagtgatttggagactctgaagaaatgcctgaagttctatcgcactgtgtttggg
gtggatgatgcagctttgcagagtttagctaaggactggcaaatgccgttggttgagctc
gaggccatgatgaaatctccgatcgtgttcaaacctacagatgaagaaacaatacatgaa
aggctttcaagatattatcatgattactgttcggctaatggacatttatttactgatgat
cgtgatcttagagaaatatcttacctgaaatattatttccttgacatagtgactgaggat
gctaaaactcttctcaaagagatatgtgtaagaaacaagttggtttctaattag

DBGET integrated database retrieval system