KEGG   Rattus norvegicus (rat): 307415
Entry
307415            CDS       T01003                                 

Gene name
RGD1309362, Ifgga1
Definition
(RefSeq) similar to interferon-inducible GTPase
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: IIGP MMR_HSR1 ABC_tran Dynamin_N AAA_16 RsgA_GTPase KAP_NTPase AAA_29 Roc Septin Sigma54_activat FeoB_N MeaB PRK AAA_24 T2SSE AAA_22 AAA_23 AAA_30
Other DBs
NCBI-GeneID: 307415
NCBI-ProteinID: NP_001020055
RGD: 1309362
Ensembl: ENSRNOG00000038960
UniProt: Q4V797
Position
18q12.1
AA seq 417 aa
MGQWFSSKNEQHQDLASSFKEYFKKFKTGHKIISEEIITSVELSMTKGNIQMANSAISEA
LREIDGTPLNVAVTGESGAGKSSFINALRGIGHEEEGAAKIGVVETTAERWPYKHPSMPN
VVIWDLPGIGTTTFPTKTYLEKMKFYEYDFFIIISATRFKKNDIDLAKAISMMKKDFYFV
RTKIDSDLRNEEEFKPRSFDREKVLQNIRFNCVKHFKENGIDEPPIFLISNRNLSDYDFP
ILMDKLISDLPVYKRHTFMLSLPNITDSAIEKKRQSLKQKIWLEAFAADLLSIIPSLTFL
LDSDLETLKKCLKFYRTVFGVDDAALQSLAKDWQMPLVELEAKMKSPIVFKPTDEETIHE
RLSRYYRDFCLANGYLVTQNLYLREIFYLKFYFLDIVTEDSKTLLKEICLRNKLVSN
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgggtcaatggttctcttcgaagaatgaacagcaccaagatttggcctccagttttaaa
gaatattttaagaaatttaagacgggacacaaaatcatttctgaggaaatcatcacttca
gttgaattaagcatgacaaaagggaacattcaaatggcaaactctgcaatcagtgaggca
ttaagagaaatcgatggtacaccgctcaatgttgctgtcaccggggagtctggagcagga
aagtccagtttcatcaatgccctgagaggcattgggcatgaagaggaaggtgcagctaaa
attggggtggtggagacaaccgcggagagatggccatacaaacaccccagtatgcctaat
gtggtcatttgggacctgcctggaattggaaccacaactttcccaacaaaaacgtatcta
gagaaaatgaaattctatgaatatgacttcttcattattatttcagccacccgctttaag
aaaaatgatatagacctcgccaaagcaatcagtatgatgaagaaggatttctactttgtg
agaaccaagatagactctgacttaagaaatgaagaggaattcaaaccacgatcctttgac
agagaaaaagtcctgcagaacatccgctttaactgtgtgaagcacttcaaggagaatggc
attgatgagccaccgatcttcttgatctctaacagaaatctttctgactatgatttccca
atcctgatggacaagctgataagtgatctccctgtatacaagcgacacactttcatgctc
tccttacccaatattacagattcagccattgaaaagaagcgacaatctttgaagcagaag
atttggctcgaagcctttgcagctgacctactgagcatcatcccttcactgaccttcctc
ttggacagtgatttggagactctgaagaaatgcctgaagttctatcgcactgtgtttggg
gtggatgatgcagctttgcagagtttagctaaggactggcaaatgccgttggttgagctc
gaggccaagatgaaatctccgatcgtgttcaaacctacagatgaagaaacaatacatgaa
aggctttcgagatattaccgggatttctgtttggctaatgggtatttagttactcaaaat
ctttatcttagagaaatattttacctgaaattctatttccttgacatagtgactgaggac
tcaaagactcttctcaaagagatatgtttaagaaacaagttggtttctaattag

DBGET integrated database retrieval system