KEGG   Rattus norvegicus (rat): 307644
Entry
307644            CDS       T01003                                 

Gene name
Kifc3, KRP4
Definition
(RefSeq) kinesin family member C3
  KO
K10406  kinesin family member C2/C3
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    307644 (Kifc3)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     307644 (Kifc3)
SSDB
Motif
Pfam: Kinesin Microtub_bd Spc7
Other DBs
NCBI-GeneID: 307644
NCBI-ProteinID: NP_001096822
RGD: 1307693
Ensembl: ENSRNOG00000014087
UniProt: A1A5P4
Position
19p13
AA seq 753 aa
MSQLQEELVVLRERLALHDSDRQATTTQLQNQVENLKEKLISQAQEVSRLRSELGGTDVE
KHRDRLMVENEQLRQELRRCEAELQELRAQPVVPCQGCEHSQESTQLRDRLSQLQLEVAE
NKGMLSELNLEVQQKTDRLAEVELRLKDCLAEKAQEEERLSRRLRDSHETIASLKAQSPP
VKYVIKTVEVESSKTKQALSESQTRNQHLQEQVAMQRQVLKEMEQQLQNSHQLTIQLRAQ
IAMYEAELERAHGQMLEEMQSLEEDKNRAIEEAFARAQVEMKAVHENLAGVRTNLLTLQP
ALRTLTNDYNGLKRQVRGFPLLLQEALRSVKAEIGQAIEEVNSNNQELLRKYRRELQLRK
KCHNELVRLKGNIRVIARVRPVTKEDGEGPEATNAVTFDPDDDSIIHLLHKGKPVSFELD
KVFSPWASQQDVFQEVQALITSCIDGFNVCIFAYGQTGAGKTYTMEGTPENPGINQRALQ
LLFSEVQEKASDWQYNITVSAAEIYNEVLRDLLGKEPQEKLEIRLCPDGSGQLYVPGLTE
FQVQSVDDINKVFEFGYNNRTTEFTNLNEHSSRSHALLIVTVRGVDCSTGLRTTGKLNLV
DLAGSERVGKSGAEGNRLREAQHINRSLSALGDVIAALRSRQGHVPFRNSKLTYLLQDSL
SGDSKTLMVVQVSPVEKNTSETLYSLKFAERVRSVELGPGSRRTELGSWSSQEHLEWEPA
CQTPQPTARAHSAPGSGTSSRPGSIRRKLQPSA
NT seq 2262 nt   +upstreamnt  +downstreamnt
atgtcccagcttcaggaggagctggtagtccttcgggagaggctggccctccatgacagt
gaccggcaagccacaaccacccagctgcagaaccaggtggagaatctaaaggaaaagctc
attagccaggcccaggaagtgagccgactgcgatcagaactggggggcaccgacgtggaa
aagcaccgggacagactgatggtggagaatgagcagctgaggcaagagctgaggcgctgt
gaggcggagcttcaggagcttcgggcacagccggtggtgccctgccagggttgcgagcac
agccaggagagcacccagctccgggacaggttatcccagctgcagctggaagtggccgag
aacaagggcatgctgtcggagctgaacctggaggtgcagcagaaaaccgaccggctggca
gaggtagagctgcggctcaaggactgcctggctgagaaagcacaggaagaggagcgactc
agccggcgcctgcgtgacagccacgagaccatcgccagtctgaaggcccagtccccacct
gttaagtatgtcatcaagacagtggaggtagagtcgtccaagaccaagcaggccctcagc
gagtcccagacccggaaccagcacctgcaggagcaagtggccatgcagaggcaggtgctt
aaggagatggagcagcagctgcagaactcgcatcagctgacaatacagctgcgggctcag
attgccatgtatgaggcagagctggagcgggcgcacgggcagatgctggaggagatgcag
tccttggaggaagataagaaccgggccattgaggaggcctttgcgcgggcccaggtggag
atgaaggctgtacacgagaacctggcaggtgtcaggaccaacctgctgacgctgcagcct
gcgctgaggaccctcaccaacgactacaatgggctcaagcgccaggtgcggggcttcccc
ctgctgctgcaggaggctctccggagtgtcaaagctgagattggccaggccattgaggag
gtcaacagcaacaaccaggagctgctgcgcaagtaccgccgggagctgcagctgcgcaag
aagtgccataacgagctggtgcggctgaagggaaacatccgggtgattgcccgagtccgg
ccagtcaccaaggaggatggggaaggacctgaggcaaccaatgctgtgacctttgaccct
gatgatgactccatcatccacctgctgcacaagggcaagcctgtgtccttcgagctggac
aaggtcttctccccgtgggcgtcccagcaggatgtgttccaggaggtgcaggccctcatc
acctcctgcatcgatggcttcaatgtctgcatctttgcttatggccagacaggcgccggc
aagacgtatacaatggagggcacccccgagaacccaggcattaatcagcgggccctgcaa
ctgctcttctcagaggtgcaggagaaggcgtccgactggcagtacaacatcaccgtcagt
gcagctgagatctacaacgaagtcctcagggacctgctggggaaagagcctcaggagaag
ttggagatccgactgtgtccagatggcagcggccagctgtatgtgccagggctgactgag
ttccaggtgcagagcgtggatgatatcaacaaggtgtttgagtttggctacaacaaccgc
accaccgagttcaccaacctgaatgaacacagctcacgctcccatgctctgctcattgtg
acggtgagaggcgtggactgcagcacaggcctccgcaccacggggaagctgaacctggtg
gacctggctggctccgagcgtgtagggaagtcgggggctgaaggcaaccgcctgcgagag
gcacagcacatcaacaggtcactgtctgccctgggggacgtcatcgctgccctgcgttct
cgacagggccatgtgcccttccgtaattccaaactcacctacctgctgcaggactcactc
agtggtgacagcaagaccctcatggtggtacaggtgtccccagtggagaaaaacaccagt
gagactctgtactccctcaagtttgctgagagggttcgctctgtggagctgggccctggg
tcccgccgtacagagttaggttcctggtcaagccaggagcatctagagtgggagccagct
tgccagacaccacagcctacagcacgagcccactctgcccctggctctgggaccagtagc
cgcccgggatccatccgaaggaaactgcagccgtcagcctga

DBGET integrated database retrieval system