KEGG   Rattus norvegicus (rat): 307988
Entry
307988            CDS       T01003                                 

Gene name
Vwa2, RGD1562000, Vwa2-ps1
Definition
(RefSeq) von Willebrand factor A domain containing 2
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: VWA VWA_2 EGF hEGF EGF_2 EGF_CA
Other DBs
NCBI-GeneID: 307988
NCBI-ProteinID: XP_003749194
RGD: 1562000
Ensembl: ENSRNOG00000025581
UniProt: D4A0J4
Position
1q55
AA seq 792 aa
MRRRTRSNNMPPYLFLPAIYTLLFSRVSLSSSLQEVHVSRETTGKIAVASKLIWCSAAVD
ILFLLDGSHSIGKGSFERSKRFATALCDALDISPGRVRVGALQFGSTPHLEFPLDAFSTR
QEVKEIIKKLVFKGGRTETGLALKHLLRGLPGGRNGSVPQILIIITDGKSQGHVALPAKQ
LKERGIVVFAVGVRFPRWDELLTLASEPKEQHVLLAEQVEDATNGLLSTLSSSLLCTTAD
PDCRVEAYPCERRTLETMRELASNALCWRGSRQADTVLAVPCPFYSWKRVFQTHPANCYR
TICPGPCDSQPCQNGGTCIPEGVDRYHCLCPLAFGGEVNCAPKLSLECRIDVLFLLDSSA
GTTPEGFRQAKAFVKRFVQAVLSEDSRARVGVASYSRDLMVAVPVGEYQHVPDLVRILDS
IPFSGGPTLTGSALLQVTEHGFGSASRTGQDRPRRVVVLLTESHAQDEVAGPADHARARE
LLLLGMGNELMRAELERITGSRKHVIIHTDPRDMFSQIPELQRRLCSQPRPGCQAQSLDL
VFLLDASASVGGENFAQMQSFIRKCTLRFDVNPDVTQVGLVVYGNQVQTAFGLDTHPTRA
SVLRAMSQAPYLGGVGSAGTALLHIEDKVMTVQRGARPGVPKAVVMLTGGSGAEDAAVPA
QKLRDNGISVLVMSVGAVLKEAVRRLAGPRDYLIHVAAYTDLRYHQDTLIEWLCREAKRP
VSLCKPSPCMNEGTCILKNGSYRCECWGGWEGPHCENRVLRGDAPMAHSFRREPTGRQQP
TPSQQAPKHVGV
NT seq 2379 nt   +upstreamnt  +downstreamnt
atgcggcgccgcaccaggtctaacaacatgcctccatatctgtttctaccagccatctac
actctcctgttctccagagtttccctgtccagctctcttcaggaagtgcatgtgagccgg
gagaccacgggaaagatcgcagtggccagcaaattgatatggtgctcagccgcggtcgac
atcctgttcctgttagatggctctcacagcattgggaaagggagcttcgagaggtccaag
cgctttgccactgctctctgcgatgccctggacatcagtcctggcagggtcagagtgggc
gccttgcagtttggttccactcctcatctggaattccctttggatgccttttcaacccga
caggaagtgaaggagatcatcaagaagttggtttttaaaggtgggcgcacagagacaggc
ctagccctgaaacacctgctcagagggctccccggaggaagaaatggctctgtgccccag
atcctcatcatcatcacagacggcaagtcccaggggcacgtggctctgccggctaagcag
ctgaaagaaaggggtatcgttgtgtttgcagtaggggtccgttttcccaggtgggatgag
ctgctgacgctggccagcgagccgaaggagcagcatgtgctgttggccgagcaagtggag
gatgccaccaatggcctcctcagcaccctcagcagctccttgctctgcaccactgctgat
ccagactgcagggtggaagcttacccgtgtgagcggagaacgctggagaccatgagagag
ctcgccagcaatgccttgtgctggagaggatcaaggcaggcggacactgtgctggctgtg
ccctgtcccttctacagctggaagagagtgttccagactcaccccgccaattgctacaga
accatctgtccaggcccctgtgactcccagccatgccaaaatggaggcacgtgcattcca
gaaggtgtggacaggtaccactgtctctgcccactggcattcggaggggaagtcaactgt
gccccgaagctgagcctggaatgcaggatcgatgtcctcttcctgctggacagttctgca
ggcaccactccggagggcttccgtcaggccaaggcctttgtgaagcgctttgtgcaggcc
gtgctgagtgaggactcccgagcccgtgttggggtagccagttacagcagggatctaatg
gtggcggtgcctgttggggagtaccagcatgtgccagacctggtcaggatccttgacagc
attcccttcagcggtggcccaactctgaccgggagtgccttgctgcaggtgacagagcat
ggctttgggagtgccagccggacaggacaggacaggccacgcagagtagtggttctgctc
actgaatcacacgcccaagatgaggtggctgggccagcagatcatgcgagggcccgggag
ctgctactcctgggcatgggaaatgagctcatgcgggcagagctggagaggatcacgggt
agccggaagcatgtgatcatccacacagaccctcgggacatgttcagccaaatcccagag
ctgcagaggaggctatgtagccaaccacggccaggctgccaggcacagtcactagacctg
gtcttcctgttggatgcctctgcctcagtgggaggtgagaactttgctcaaatgcagagc
ttcatcaggaaatgcaccctccgctttgatgtgaatcctgacgtgacacaggttggcctg
gtggtatacggtaaccaggtgcagaccgctttcggacttgacacccatcccacccgtgct
tctgtgctgcgggccatgagccaggccccctacctagggggtgtgggctctgctggcaca
gccttgctgcacattgaggacaaggtgatgacggtccagaggggagcccgccccggtgtc
cccaaggctgtggtgatgctcacaggtggcagtggggcagaagatgcagctgtccctgcc
cagaagctgagagacaatggcatctcagtcttggtaatgagtgtgggagctgtcctcaag
gaggcagtgaggaggcttgctggtccacgggactacctgatccatgtggcagcttacaca
gacctgcggtaccatcaggacacgctcatcgagtggctatgcagagaagccaagcggcca
gtcagcctctgcaaacctagcccatgcatgaatgaaggcacctgtatcctgaagaacggc
agttaccgatgcgagtgctggggtggctgggaaggcccccactgtgagaaccgcgtcttg
agaggagatgcccccatggcacacagcttccgccgagagcctacaggaagacaacagcca
accccctcccagcaagctcccaagcatgttggagtctga

DBGET integrated database retrieval system