KEGG   Rattus norvegicus (rat): 308099Help
Entry
308099            CDS       T01003                                 

Gene name
Fndc1
Definition
(RefSeq) fibronectin type III domain containing 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: fn3 Pur_ac_phosph_N Interfer-bind
Motif
Other DBs
NCBI-GeneID: 308099
NCBI-ProteinID: NP_001033704
RGD: 1310640
Ensembl: ENSRNOG00000030210
UniProt: Q2Q0I9 A0A128E118
Position
1q11
AA seq 1730 aa AA seqDB search
MGLKVTWDPPKDATSRPVEHYNIAYGKSLKSLKSIKVNAETHSFLIKDVEKEVPNKPLRM
RVRASDDRLSVAWKAPRLSGAKSPRRSRGFLLGYGESGRKMNYVPLTRDERSHEIKKLAS
ESVYVVSLQSTNSQGQSQPVYRAALTKRKNAEEDELDVPEDISVRVMSSQSVLVAWVDPL
VEKQKRVVASRQYTVRYREKGESARWDYKQVSNRRALVDSLIPDTVYEFAVRISQGERDG
KWSASVFQRTPESAPTTAPENLRVWPVNGKPTVVTVSWDALPESEGKVKEYILSYAPALK
PFGAKSLTFSGHTTSALVDGLQPGERYLFKIRATNRRGQGPHSKAFIVAIPTTSSTEASV
QPNGRDNGKPEKPQQPSSSAPKVAASSQHTPSAKNVKDALSDLKNKIQTNGVAPGRTQLH
SKVGELDPQSTEVTGEEELDSLEDPRSSRLETLNQKQPLRVPSRSGHGALAPGRTPARAG
LPVLSRKEGMDRRGPSLDPHPHPRVEPSASSAYHQLSSTDNDSVDRKEDDQAGSPDPKAA
SSGSSPKNPGRSRPTSAPSRHAASNMLRDKSRVHPGTKAASSSTSRQSHSSTSEEDSSAQ
PSRHFPLHRGSSTSPLSRGWKDRQDTHASSSHTTSRTASSSHPSALTEGSEEEDGGADSD
RAAEDTIRRAEATAQIQQTRPGLGHFSLIRNKPFTPHSRNPNRFPRLRGPRLQPSVSPQS
TSASKVLTRSPSLPASHTRPGSDVYGDGEDEEPLPATVINDRTPSYPRHPISGSSDTLRR
GPQRGASLYRKEPIPENSKAAGADVPPGGRSPLSSKAQGFQQSTTDEGAPQTSPASTSRQ
PSPARPPASRSQPSPGSTVPRRMTPDRSSELSSSQSKDRSLSQPKLSVAHAGHDHPHTAN
SRGVLPSAPQNQNEGAQSTYEDNSTEIEGPDSRTPTHSARAKDTTPPILKPRQVGSQSWS
SDNRPQRSQAGASERPIRPGSTHPRAQVPGRAGVQATSVKKVSPSKRPLPLESQQSVFAE
EEEENEGMLKGKEDSLSTSVKKWPSSSSPRDKYADRNLDKDKAAIGLLVQEENTVPGRRP
PGSPAIASHPSTRHQPRNPATASPIANTHSWPRYTTRAPSSYSSTTPMLSLRQRMQRRFR
TPVSRQPPPPRPVLTPGYNGRPNAEENIPPGSIGKPNGQRIINGPQGTKWVVDLDRGLVL
NAEGRYLQDSHGNPLRVRLGGDGRTIVDLGGTPMVSPDGLPLFGQGRHGKPVASAQDKPI
LSLGGKPLVGLEVVRTTTQVPTTTMPPSTTTTTVPPTTTLPPTTTTTRRTTTTRRTTTTR
RPTTTTRATRRTTTTTTTPEPTTPSPTCPPGTLEHRDEAGNLIMGSNGIPECYLEEDDFS
GLEIDTALPTEEDYVVYDDDYGLETTRPPTSTMPSTTAATPKVVPEQGTVSSFPEEEFDL
AGKRRFVAPYVTYLSKDPAAPCSLTDALDHFQVESLDELIPNDLTKNDLPPQHAPRNITV
VAMEGCHSFVIVDWNKAIPGDVVTGYLVYSASYEDFIRNKWSTQTSSVTHLPIENLKPNT
RYYFKVQAKNPHGYGPVSPSVSFVTESDNPLLVVRPPGGEPIWIPFAFKHDPGYTDCHGR
QYVKRTWYKKFVGVVLCNSLRYKIYLSDNLKDTFYSIGDSWGRGEDHCQFVDSHLDGRTG
PQSYVEALPTIQGYYRQYRQEPVSFGHIGFGTPYYYVGWYECGVSIPGKW
NT seq 5193 nt NT seq  +upstreamnt  +downstreamnt
atgggcctgaaggtcacatgggacccacccaaagacgctaccagtagacccgtggaacat
tacaacattgcctatgggaagtcactgaaaagtcttaagtccatcaaggtgaatgcggag
acacactccttccttattaaagacgtggaaaaggaagtgcccaacaagcccttgcgtatg
cgcgtccgagcctcagatgacaggctgtctgttgcatggaaggcaccacgtctgtctgga
gccaagagcccacggagatctcggggttttcttctgggctatggggaaagtggccggaag
atgaattatgtcccactgaccagagatgagagatcgcatgaaattaaaaagcttgcctct
gagtcggtgtatgtggtctccctgcagtccacaaactcccaggggcagagtcagcccgtc
tatagagctgccctcacaaagcgcaagaatgcagaagaggatgaactggatgtacctgaa
gacattagtgtccgggtcatgtcgtctcagtccgtgctcgtggcctgggtggatcctctt
gtggaaaaacagaagagagttgttgcatcaagacagtacactgtgcgctaccgtgagaag
ggggagtcggccaggtgggattacaagcaagtctccaacaggcgtgcactggtggacagc
ctgatcccagacaccgtgtatgaatttgcggtccgtatttcacaaggagagcgagatggc
aagtggagcgcatctgtcttccagagaacgccggaatcggctcccaccacagcgcctgag
aacctgagagtctggccagtcaacggcaagcccacggttgtcaccgtatcctgggatgca
ttgccagagtctgaggggaaagtgaaagaatacattctttcatatgccccggctctcaaa
ccgtttggagcaaagtccctcaccttctctggacatactacttctgccctcgtggacggt
ctgcagcctggggaacgctatctgttcaaaatccgggccacaaacaggagaggccagggg
ccacactccaaagccttcattgtcgctataccaacaaccagttctactgaagccagtgtc
cagccgaatgggagagacaatgggaaacctgagaaaccacagcaaccttcttcctctgct
cccaaagttgcagcttcctcacaacacacgccctcagccaaaaatgtcaaggatgctctc
tcggacttaaagaacaaaatccagactaatggtgtggcgcccggaagaacccagcttcac
tctaaagtgggtgagctggatcctcagtccacagaagtcactggcgaggaggaactggat
tcccttgaagatcctcgttcatcacggttggagaccctaaaccagaagcaacccttgagg
gtaccaagtagatctggtcatggggctctggctcctggcaggactccagccagggctggc
ctgccagtgctgtcccgcaaggaagggatggacaggcgtggcccctcactggacccccat
cctcatcctagggttgaaccttcagcttcttctgcctaccaccagctcagctctacagac
aatgattctgtggaccgaaaggaggatgatcaagcaggatcccctgaccctaaagctgcc
tcttccgggtcatctcccaagaatccaggcaggtccaggccaacctctgcccctagccgc
catgcggcttctaacatgctcagagacaaaagccgggtacacccaggtacaaaggcagca
tcatcatctacgtcgaggcagtctcattcttccaccagtgaggaagactccagtgcccaa
ccctcgagacatttcccactgcatagaggatcttctacatccccgctttctaggggctgg
aaggaccgccaggatacccatgcctctagttcccatacgacttcccggaccgccagctct
tctcatccctctgccctgacagagggctctgaggaagaggatggcggcgctgatagtgac
agagctgcagaagacaccatcaggcgggctgaggccactgctcagatccaacagacccgg
cctggcttgggtcactttagtttgatacggaataaacccttcactcctcacagcagaaat
ccaaacagattccccaggctccgtggaccaaggcttcagccttctgtgtctcctcagtct
acctcagcctcgaaagtcctcaccaggtctccttcgctgccagcatcccacactaggcct
ggctctgatgtctatggagatggtgaggatgaagagcctcttccagccactgtgatcaat
gaccgtacaccttcctatcccaggcacccaatctctggcagctcagacactctgagaaga
ggtccccagagaggggccagcttgtaccggaaggagcccatcccagaaaactccaaagct
gctggagcggatgtacctcctgggggcagatcccctctgtcctccaaggctcagggcttt
caacagagcaccaccgatgaaggtgctcctcaaacatccccagcatccaccagccgccag
ccgtctcctgctagacctccagcatcaagatcacagccctcccccgggtccactgttccc
agaagaatgacacccgatcgcagctcagaactctctagttctcagagcaaggatcggtca
ctttcccagcccaagctgtccgtcgctcacgcagggcatgaccaccctcacactgcaaac
tcccgtggggtgctcccctcagctccccagaatcagaatgagggtgcccagagcacctac
gaggacaacagcactgaaattgagggtccagactcccggactcccactcattcagctcga
gccaaggataccactccacccattctcaaacctcggcaggtgggctcccagtcatggagc
agtgacaacagacctcagcgcagccaggcaggagcctctgaaagacccatccggcctggc
agcacccacccacgggcccaggttcctggcagggctggggtccaggccacgtcagtgaag
aaggtctcaccttccaagcggcccctgccactcgaatctcagcaatcggtcttcgctgag
gaggaagaggaaaacgaaggaatgttaaaaggcaaagaagattctctgtctacctcagtt
aaaaagtggccttcttcctcctccccgcgggacaagtacgcagacaggaaccttgacaaa
gacaaggctgccattgggctccttgtacaggaagagaacaccgtccccggaaggcgacca
ccaggcagccccgcaatagcctcacacccatctacccggcaccagcctcgaaatcccgcc
actgcaagtcccatcgcaaacacacactcctggccaaggtataccacccgggccccttcc
agctactcctccaccacaccgatgctctccttgcggcagcggatgcagcggaggtttagg
acgccagtctcgcgccagcctccaccacccagacccgtgcttacaccaggttataatgga
agaccaaatgcagaagagaacatacctcctggtagtattggaaaaccaaacggacagaga
attattaatggtcctcaaggaacaaagtgggttgtagacctggatcgtggcttggtgttg
aatgcagaagggcggtacctccaagactcccacggcaatcctctccgggtgagactcggg
ggagacggtcgcaccatcgtggatcttggaggaacccctatggtgagtcccgatggcctc
cccctgtttgggcaaggaagacatggcaaacctgtggccagtgcccaggataaacccatc
ttgagtcttggagggaagcccttagtgggcttggaagtggtcagaacaaccacccaagtt
cctaccacaaccatgccgccaagcacaacgaccaccactgtgccgcccaccacaaccctg
ccgcccacaaccaccaccacccgccggaccaccaccacccgccggaccaccaccaccagg
cgtcccacaaccacaacccgagctactcgcaggacaactaccactaccaccactccggaa
cctaccaccccctctcctacctgtcctcctgggaccctggaacaccgggatgaagctggc
aacctcataatgggctcaaatgggatcccagagtgctacctcgaggaagatgacttctcg
ggcctggagatagacacggcactacccacggaagaggattatgttgtgtacgatgatgat
tatggacttgagaccacaaggccaccgaccagcaccatgccctcaaccactgctgccaca
ccgaaggtcgtcccagagcagggcactgtcagctccttcccagaggaagaatttgacctt
gccggaaagaggcggtttgttgctccttacgtgacctacctcagtaaagacccagcagcc
ccgtgctcactgactgatgccctggaccacttccaagtggaaagcctggatgaactcatt
ccaaatgacctgacaaagaacgatctccctcctcagcatgctccccggaacattactgtg
gtcgccatggaaggctgccactcctttgtcattgtggactggaacaaagccatccctgga
gatgtggtaacaggatacctggtctacagcgcctcttatgaggacttcatcaggaataaa
tggtcaactcagacctcgtcagtgacccatttgcccattgagaacctgaagccaaacaca
aggtattacttcaaagttcaagcgaaaaaccctcacggctatgggcctgtcagcccttca
gtctcatttgtcacagaatcagacaatcctctgctggttgtgaggccaccaggtggtgag
cccatctggatcccgtttgctttcaagcatgaccccggctacactgactgccatggtcgg
cagtatgtgaaacggacgtggtacaaaaagtttgtgggagttgttctttgtaattctcta
aggtacaagatctacctcagtgacaatctcaaagacacattctacagcattggggacagc
tggggaaggggtgaagaccattgtcagtttgtggattcgcacctggatggaagaacgggg
cctcagtcttatgtagaagccctccccaccattcaaggctactatcgccagtaccgtcag
gagcccgtcagctttggacacattggatttggaaccccctattactatgtgggctggtac
gagtgtggagtctccatcccaggaaagtggtaa

DBGET integrated database retrieval system