KEGG   Rattus norvegicus (rat): 308267
Entry
308267            CDS       T01003                                 

Gene name
Tab2
Definition
(RefSeq) TGF-beta-activated kinase 1 and MAP3K7-binding protein 2
  KO
K04404  TAK1-binding protein 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04064  NF-kappa B signaling pathway
rno04380  Osteoclast differentiation
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04657  IL-17 signaling pathway
rno04668  TNF signaling pathway
rno05132  Salmonella infection
rno05135  Yersinia infection
rno05140  Leishmaniasis
rno05145  Toxoplasmosis
rno05161  Hepatitis B
rno05162  Measles
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    308267 (Tab2)
   04064 NF-kappa B signaling pathway
    308267 (Tab2)
   04668 TNF signaling pathway
    308267 (Tab2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    308267 (Tab2)
   04621 NOD-like receptor signaling pathway
    308267 (Tab2)
   04657 IL-17 signaling pathway
    308267 (Tab2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    308267 (Tab2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    308267 (Tab2)
   05161 Hepatitis B
    308267 (Tab2)
   05171 Coronavirus disease - COVID-19
    308267 (Tab2)
   05162 Measles
    308267 (Tab2)
   05168 Herpes simplex virus 1 infection
    308267 (Tab2)
   05169 Epstein-Barr virus infection
    308267 (Tab2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    308267 (Tab2)
   05135 Yersinia infection
    308267 (Tab2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    308267 (Tab2)
   05140 Leishmaniasis
    308267 (Tab2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    308267 (Tab2)
SSDB
Motif
Pfam: CUE Spc29 DivIC HIP1_clath_bdg
Other DBs
NCBI-GeneID: 308267
NCBI-ProteinID: NP_001012062
RGD: 1309527
Ensembl: ENSRNOG00000016054
UniProt: Q5U303
Position
1
AA seq 627 aa
MAQGSHQIDFQVLHDLRQKFPEVPEVVVSRCMLQNNNNLDACCAVLSQESTRYLYGEGDL
NFSDESGISGLRNHMTSLNLDLQSQNVYHHGREGSRVNGSRTLTHSVSDGQLQGGQSNNE
LFQQEPQTAPAQVPQGFNVFGMPSTSGASNSTPHLGFHLGSKGTSNLSQQTPRFNPIMVT
LAPNIQTGRSTPTSLHIHGVPPPVLNSPQGNSIYIRPYITTPSGAARQTQQHSGWVSQFN
PVNPQQAYQPSQPGPWTTYPASNPLPHTSTQQPNQQGHQTSHVYMPISSPTTPQPPTVHS
SASSQSSAHSQYNIQNISTGPRKNQIEIKLEPPQRNSSSKLRSSGPRTASTSSLVNSQTL
NRNQPTVYIAASPPSTDEMISRSQPKVYISANASTGDEQGMRNQPTLFISTNSGASAASR
NMSGQVSMGPAFIHHHPPKSRVLGGNSAASPRVVVTQPNTKYTFKITVSPNKPPAVSPGV
VSPTFELTNLLNHPDHYVETETIQHLTDPTLAHVDRVSEARKLSMGSDDAAYTQALLVHQ
KARMERLQRELEMQKKKLDKLKSEVNEMENSLTRRRLKRSNSMSQIPSLEEMQQLRSCNR
QLQIDIDCLTKEIDLFQARGKVQCILS
NT seq 1884 nt   +upstreamnt  +downstreamnt
atggcccaaggaagccaccaaattgattttcaggttttacatgacctgcgacaaaagttc
cctgaagtgcctgaagttgttgtatccaggtgcatgttacagaacaataataacctggat
gcctgctgtgctgttctctctcaggagagtacaaggtatctttacggtgaaggagacctg
aatttttcagatgagtctggaatttctggtctacgcaatcacatgacttctctcaacttg
gacttgcagtcacagaatgtttaccaccatggaagagaaggaagtcgagtgaacggaagt
aggactttaacacacagtgttagcgatggacagcttcaaggtgggcagtccaataacgaa
ctgtttcagcaggagccacaaacagcaccagctcaagttcctcaaggctttaatgttttt
ggaatgcccagtacatctggtgcttctaattcaacaccacatcttggatttcacctaggc
agcaaagggacatcaaacctctctcaacaaactcccaggtttaatcctattatggtaact
ttagccccaaacatacagactggccgaagcacccctacgtctttgcacatacatggtgtg
cctccacctgtactcaacagcccacaggggaattctatctacattaggccttacatcaca
actcctagtggtgcagctcgacagacacagcagcattctggctgggtatctcagtttaat
cccgtgaaccctcagcaagcctatcagccttcacagcctggaccttggactacttatcct
gcatccaatcctttgccacatacctcaacccagcagccgaatcagcagggccatcagacc
tctcatgtctacatgcctatcagttcgccaactactccacaaccgccaacagttcactcg
tctgctagctctcagtcttctgcccatagccaatataacattcagaatatttcaacagga
cctcgaaaaaaccagatagaaatcaaacttgaacccccacaaagaaacagttcttcaaaa
ttacgttcttctggacctcgaactgccagcacttcctcattggtcaacagccagacctta
aatagaaatcagcccactgtttacatagctgccagtcctccaagcactgatgagatgatc
tcccgtagtcaacccaaggtctacatctcagccaatgccagcacaggagatgagcagggc
atgcggaatcagcctacactcttcatatccacgaactctggggcctctgcagcctccagg
aacatgtctgggcaagtgagcatgggtcctgcctttatccaccaccaccctcccaaaagc
cgggtgttaggtggcaactccgcagcctcccctcgagtggtggtgacgcagcccaacaca
aagtacaccttcaaaatcacagtttctcccaataagccccctgccgtctccccgggggtt
gtctcccccacctttgaacttacaaatcttctgaatcaccctgaccattatgtagaaaca
gagactattcagcacctcacagaccctactctagcacacgtggatagagtaagcgaagca
cggaaactgagtatgggatctgatgatgctgcctacacacaagctctgctggtgcaccag
aaggccaggatggaacggcttcaaagagagctcgagatgcagaagaaaaagctggacaaa
ctcaaatctgaggtcaatgagatggaaaacagtctaacgcgaaggcgcctgaagaggtcc
aactccatgtcccagataccttcactcgaagaaatgcagcagttgagaagttgtaataga
caactccagattgacattgactgcttaaccaaagaaattgatctttttcaagcccgaggt
aaagttcagtgcattctcagctga

DBGET integrated database retrieval system