KEGG   Rattus norvegicus (rat): 308387
Entry
308387            CDS       T01003                                 

Gene name
Npas1
Definition
(RefSeq) neuronal PAS domain protein 1
  KO
K09098  neuronal PAS domain-containing protein 1/3
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    308387 (Npas1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    308387 (Npas1)
SSDB
Motif
Pfam: PAS_3 PAS PAS_11 HLH PAS_4
Other DBs
NCBI-GeneID: 308387
NCBI-ProteinID: NP_001100949
RGD: 1310040
Ensembl: ENSRNOG00000015376
UniProt: D3ZJ66
Position
1q21
AA seq 595 aa
MATPYPRSGGRGEVKCGGGRGAGVPWDFLPGLMVKAPPGPCLQAQRKEKSRNAARWRRGK
ENLEFFELAKLLPLPGAISSQLDKASIVRLSVTYLRLRRFAALGAPPWGLRAVGPPAGLA
PGRRGAVALVSEVFEQHLGGHILQSLDGFVFALNQEGKFLYISETVSIYLGLSQVELTGS
SVFDYIHPGDHSEVLEQLGLRAATTGPPTPPSVSSTSSSSSSSSLVDTPEIEASPTEASP
AFRVQERSFFVRMKSTLTKRGLNVKASGYKVIHVTGRLRARALGLVALGHTLPPAPLAEL
PLHGHMIVFRLSLGLTILACESRVSDHMDMGPSELVGRSCYQFVHGQDVTRIRQSHLDLL
DKGQVVTGYYRWLQRAGGFVWLQSVATVAGNGKSAGEHHVLWVSHVLSHAEGGQTPLDAF
QLPAIVSQEESSSPGPEPTKEEPPVERKQTVPVEQDKDKDPQARGKRIKVEASPKEVRGS
EDSGEEEVSDPPAPPRPEFTSVIRAGALKHDPVLPWGLTTPGDPSPALLHAGFLPPVVRG
LCTPGTIRYGPAELSLMYPHLHRLGPGPSLPEAFYPTLGLPYPGPTGTRVQRKGD
NT seq 1788 nt   +upstreamnt  +downstreamnt
atggcgaccccctatcccagaagcggtggccgaggtgaagttaagtgcgggggaggccgt
ggagccggcgtcccctgggatttcctgcccgggctgatggtcaaggcccctcccggaccc
tgcctgcaggcgcagcgcaaagagaagtcccgcaacgcggcgcgctggcggcgcggaaag
gaaaatctcgagttcttcgagctggccaagttgctccctctgcccggtgccatctccagt
cagctggacaaggcgtccatagtgcgtcttagcgtcacatacctccgcctgcgtcggttt
gcggctctgggagcgcctccctgggggttgcgggccgtcgggcctcccgctggcctcgcc
ccaggtcgccgaggcgctgtggctctggtgtctgaagtcttcgagcaacacctaggtgga
cacatcctacagtccttggatggcttcgtgttcgccttgaaccaggaagggaaattcctc
tacatctcagagacagtgtccatctacttgggtctctcacaggtggagctgacgggcagc
agcgtcttcgactacatccatcctggggaccactcggaggtcctagagcaacttggactg
agggccgcaaccactggcccccctacgccgccttctgtgtcctccacttcctcctcgtcg
tcttcctcctcgctggtggacacccccgagattgaagccagccccacggaggcatcccct
gccttccgggtccaggagcggtccttctttgtccgaatgaagtctaccctcaccaagagg
ggtctgaatgtcaaagcctcggggtacaaggtcattcatgtgacaggacgcctgagggcc
cgagcgctgggtcttgtagcccttggacacacgctgcccccagccccgctggctgagctg
cctctgcatggacacatgattgtgtttcgcctcagcctgggcctcaccatccttgcttgt
gagagcagagtgagcgaccatatggacatggggccctcagaactggtgggacgcagctgc
tatcagtttgtccacggacaggatgtgaccaggatccgccaaagccatctggacctgctg
gacaaagggcaggtggtgactggttactaccgttggctgcagcgtgcggggggcttcgtg
tggctgcagtctgtagccactgtggccgggaacgggaagagtgctggggagcatcacgtg
ctgtgggtcagtcacgtgctcagccatgctgaaggtggtcaaacacccctggatgccttc
cagcttccagccattgtgtctcaggaggagtcatccagcccaggcccagagcccacaaag
gaagagcctccagttgagcggaaacagactgtgcctgtggaacaggacaaggacaaggac
cctcaggcccgaggcaaacgcatcaaagtggaggccagcccgaaggaagttagaggctca
gaagacagtggagaggaagaggtctcggatccaccggctccgcctcggccggaattcact
tctgtcattagagcaggggccctgaagcatgatccagtactgccgtggggtttgacaact
cctggagacccctcgcctgccctccttcatgcaggcttcctgccacccgttgtgcgaggc
ctgtgtaccccaggcaccatccgttatggccctgcagagttaagcctgatgtatccacat
ctgcacaggctgggtccaggcccctcgcttccagaggccttttaccctacgctgggcctg
ccctatccggggcccacaggtactagggtgcagcgaaagggagactga

DBGET integrated database retrieval system