KEGG   Rattus norvegicus (rat): 308463
Entry
308463            CDS       T01003                                 

Gene name
Map3k10
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 10
  KO
K04418  mitogen-activated protein kinase kinase kinase 10 [EC:2.7.11.25]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05016  Huntington disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    308463 (Map3k10)
   05022 Pathways of neurodegeneration - multiple diseases
    308463 (Map3k10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    308463 (Map3k10)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     308463 (Map3k10)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: TKL group
  MLK family
   308463 (Map3k10)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH3_9 SH3_1 SH3_2 Pkinase_fungal RNase_Y_N
Other DBs
NCBI-GeneID: 308463
NCBI-ProteinID: NP_001178550
RGD: 1308381
Ensembl: ENSRNOG00000023521
Position
1
AA seq 942 aa
MEEEEGAAAREWGATPAGPVWTAVFDYEAVGDEELTLRRGDRVQVLSQDCAVSGDEGWWT
GQLPSGRVGVFPSNYVAPAAPAAPTDLQLPQEIPFHELQLEEIIGVGGFGKVYRALWRGE
EVAVKAARLDPERDPAVTAEQVRQEARLFGALQHPNIIALRGACLSPPNLCLVMEYARGG
ALSRVLAGRRVPPHVLVNWAVQVARGMNYLHNDAPVPIIHRDLKSINILILEAIENHNLA
DTVLKITDFGLAREWHKTTKMSAAGTYAWMAPEVIRLSLFSKSSDVWSFGVLLWELLTGE
VPYREIDALAVAYGVAMNKLTLPIPSTCPEPFARLLEECWDPDPHGRPDFGSILKQLEVI
EQSALFQMPLESFHSLQEDWKLEIQHMFDDLRTKEKELRSREEELLRAAQEQRFQEEQLR
RREQELAEREMDIVERELHLLMSQLSQEKPRVRKRKGNFKRSRLLKLREGSSHISLPSGF
EHKITVQASPTLDKRKGSDGASPPASPSIIPRLRAIRLTPVDCGSSGGSGTWSRSGPPKK
EELVGGKKKGRTWGPSSTLQKERAGGEERLKALGEGSKQWSSSAPNLGKSPKHTPMAPGF
ASLNEMEEFAEADEGNNVPPSPYSTPSYLKVPLPAEASPCAQPPWEPPAATPSRPGHGAR
RRCDLALLGCATLLSAVGLGADVAEARAGDGEEQRGWLDGLFFPRPGRFPRGLSPTGRPG
GRREETAPGFGLAPSATLVSLSSVSDCNSTRSLLRSDSDEAAPTAPSPPPSLLPPSPSTN
PLVDVELESFKKDPRQSLTPTHVTAAHAVSRGHRRTPSDGALRQREPPELTNHGPGPRDP
LDFPRLPDPQALFPTRRRPLEFPGRPTTLTFAPRPRPAASRPRLDPWKLVSFGRTLSISP
PSRPDTPESPGPLSVQPTLLDMDMEGQSQDNTVPLCGAYGSH
NT seq 2829 nt   +upstreamnt  +downstreamnt
atggaggaggaggagggggcggcggccagagagtggggcgcgacccccgcggggccagtg
tggaccgccgtgttcgactacgaggcggtgggcgacgaggagctgaccctgcggagaggc
gatcgcgtccaggtgctttcccaggactgtgcggtgtctggagatgagggctggtggaca
gggcagctgcccagcggccgagtgggcgtcttccccagcaactacgtggcccccgctgca
cccgctgcacccacagacctccagctgccacaggagatcccctttcacgagctgcagctg
gaggagatcatcggtgtggggggctttggcaaggtctaccgcgccttatggcgtggagag
gaagtagcggtcaaggccgcccggctggaccctgaacgggacccagcagtgacagcggag
caggtgcgccaggaggcccggctctttggagcccttcagcaccccaacatcattgccctg
aggggcgcctgcctcagccccccaaacctctgcctggtgatggaatatgctcggggaggt
gcattgagcagggtactggcaggtcgccgggtcccccctcatgtgctggtcaactgggct
gtgcaggtggcacggggcatgaactatctgcacaatgatgcccctgtacccatcattcac
cgggacctcaagtccatcaacatcctaattctggaggccattgagaaccacaacctcgct
gacacggtgctcaagatcacagacttcggccttgcccgagagtggcacaagacgaccaaa
atgagtgcggcggggacctacgcctggatggctcctgaggttatccgcctctccctcttc
tccaaaagcagcgatgtctggagcttcggggttcttctttgggagctgctgaccggggag
gtcccctaccgagaaatcgacgccttggccgtggcttacggtgtggctatgaacaagctg
acgctacccatcccctccacgtgccccgagccctttgcccgcctactggaggaatgctgg
gacccagaccctcatgggcgaccagattttggcagcatcttgaagcagctggaggtcatc
gagcagtcagccctgttccagatgccactggagtccttccactcactgcaggaagactgg
aagctggagattcagcatatgttcgatgaccttcggaccaaggagaaggaattgcgcagc
cgtgaagaagagctgttgcgggccgcacaggagcagcgttttcaggaagagcagctgcgg
cggcgggagcaggagctggccgagcgagagatggacattgtagaacgtgaactgcacctg
ctcatgagccagctgagccaggagaagcccagggtccgcaaacgcaagggcaacttcaaa
cgcagccgcttgctcaagctacgggaaggcagcagccacatcagcctgccctccggattt
gaacacaagatcactgtccaggcctcccccaccctggacaagaggaaaggatctgatggg
gccagccctcctgccagccccagcatcattccccggctgagggccattcgcttgaccccc
gtagactgtggcagcagcggtggcagtggaacatggagccgcagtgggccaccaaaaaag
gaagaactggttgggggcaagaagaaaggcaggacgtggggtcccagttctactttacaa
aaggagcgggccggaggagaggagaggctcaaggccctgggggaaggaagcaagcagtgg
tcctcgagcgcccccaacctgggcaaatcccctaagcacacccccatggccccaggcttc
gccagcctcaatgagatggaagaatttgcggaggcagatgaaggcaacaacgtgccccct
tccccctactccaccccgtcctacctcaaggtgcctctgcccgccgaggcctctccttgt
gctcagccgccttgggagccgccggctgcgaccccctcccggccgggacacggagctcgg
aggcgctgtgatctggctctgctgggctgcgccacgctgctgagtgcggtgggcctgggc
gccgacgttgccgaggcacgggccggggatggtgaggagcagcggggctggctggacggt
ctcttcttcccacggcccggccgcttccctcggggtctcagcccgacagggcgcccagga
ggtcgccgcgaagagacagccccaggctttggcctggcaccctcggccaccctggtgtct
ttatcttctgtatctgattgcaactctacgcgctcattgctgcgctctgacagtgatgag
gctgcccccactgcgccctccccgccgccttctctgctcccgccctcacctagcaccaat
cctcttgtggacgtagagctggagagcttcaagaaggacccccggcagtcgctcacgccc
acccacgtcactgcggcccacgctgtgagccgtggacacagacggacaccatcggatggg
gctctgagacagcgggagcctccagagctcaccaaccacggcccaggtcctcgagatccc
ttggacttccctcgactgcccgacccccaggccctgttccctacccgacgccggcccctg
gagttccctggccgtcccaccaccctcacctttgccccaagaccccggccagctgccagc
cgcccccgtctggacccctggaaactggtctcctttggccggacactcagcatctcgcct
ccaagcaggccagacactccagagagccctgggcccctcagcgtgcagcccacgctgctg
gacatggacatggagggtcagagccaggacaatacagtgcccctgtgtggggcctatggc
tctcactga

DBGET integrated database retrieval system