KEGG   Rattus norvegicus (rat): 308576
Entry
308576            CDS       T01003                                 

Gene name
Pnkp
Definition
(RefSeq) polynucleotide kinase 3'-phosphatase
  KO
K08073  bifunctional polynucleotide phosphatase/kinase [EC:3.1.3.32 2.7.1.78]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    308576 (Pnkp)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rno03400]
    308576 (Pnkp)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.78  polynucleotide 5'-hydroxyl-kinase
     308576 (Pnkp)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.32  polynucleotide 3'-phosphatase
     308576 (Pnkp)
Protein phosphatases and associated proteins [BR:rno01009]
 HAD phosphatases
  Other HAD phosphatases
   308576 (Pnkp)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     308576 (Pnkp)
SSDB
Motif
Pfam: PNK3P FHA_2 AAA_33 HAD Zeta_toxin Hydrolase_6 Viral_helicase1 AAA_17 FHA
Other DBs
NCBI-GeneID: 308576
NCBI-ProteinID: NP_001004259
RGD: 1303331
Ensembl: ENSRNOG00000020318
UniProt: Q6AXV0
Position
1q22
AA seq 522 aa
MSELGSRGRLWLQSPTGGPPPIFLPSDGQALVLGRGPLTQVMDRKCSRNQVELIADPETR
TVAVKQLGVNPSTVGVQELKPGVSGSLSVGDVLYLVNGLYPLTLRWEEISTPGSPPDTPP
GNPVDPEEGKDTEPQKKRMRKSSPGWESFKQLLVFTASGVKPRGKVAAFDLDGTLITTRS
GKVFPTSPSDWRILYPEIPKKLQELAAEGYKLVILTNQMGIGRGKLPAEVFKAKVEAVLE
KLGVPFQVLVATHAGLNRKPVSGMWDHLQEKGNEGIPISIGDSVFVGDAAGRPANWAPGK
KKKDFSCADRLFALNVGLPFATPEEFFLKWPAARFELPAFDPRTISSAGPLYLPESSFLL
SPNPEVVVAVGFPGAGKSTFIQKHLVSAGYVHVNRDTLGSWQRCVNSCQAALRQGKQVVI
DNTNPDIQSRARYIQCAKDAGVPCRCFSFCATIEQARHNNRFREMTDPSHAPVSDMVMFS
YRKQFEPPTLAEGFLEILQVPFRLQEHLDPALQRLYCQFSEG
NT seq 1569 nt   +upstreamnt  +downstreamnt
atgtcagagcttggatccaggggccgcctgtggctccagagccccaccggtgggccaccc
cctatattcctgccgtcggatggccaagccctggttctcggtcggggaccccttacccaa
gtgatggaccggaagtgctcccgaaaccaagtggagctgattgcagaccctgaaacccgg
acagtggcagtgaaacagctgggtgttaacccatcaactgttggggtccaggagttgaag
ccaggggtgtctggctctctaagcgtgggggatgtcctttatctggttaatggcctatat
cccctgaccctgcgctgggaagagatcagcacaccaggatccccgccagacactccacca
ggcaatcctgtggatccagaggagggaaaggatactgagcctcagaaaaagcgaatgcgg
aaatcctcccctggctgggagagctttaagcagttactggtgttcacagcgtctggagtg
aagccccggggcaaggtggctgcctttgacctagatgggaccctcatcaccacccgctct
ggaaaggtcttccccactagccctagtgactggaggattctgtacccagagattccaaag
aagctccaggagctggctgctgagggctacaagctggtaattctcaccaaccaaatgggc
atcgggagaggcaagctgccagcagaggtgttcaaggccaaggtggaagctgtattggag
aaactaggggtcccatttcaggtgctggtggcaacgcatgcaggtctaaaccgaaagcca
gtgagtggcatgtgggaccatctgcaggagaagggcaacgagggcatccccatctccatc
ggggacagtgtcttcgtgggagatgcagcagggcgcccagccaactgggccccagggaag
aagaaaaaggatttctcctgtgcagaccgcctgttcgccctcaatgttggcctacccttt
gccactcctgaagagttcttcctcaaatggccagcagcccgctttgagcttccagctttt
gacccgaggaccatctccagtgctggacccctctacctcccagagtccagtttcctcctg
agccccaacccagaggtggtggtcgcagtaggattccctggggccggcaagtccactttc
atccagaagcacctggtatcggctggatatgtccatgtgaacagagacacgctgggctca
tggcagcgctgtgtgaactcatgccaggccgcactgaggcaggggaagcaagtcgtgatt
gataacaccaacccagacatccaaagtcgggctaggtacatccagtgtgccaaagatgct
ggtgtgccctgccgctgcttcagcttctgtgccacaatagagcaggcacgccacaacaac
aggttccgtgagatgaccgacccttcacatgcgccggtatcagacatggtcatgtttagc
tacaggaagcagtttgagccgcccacactggctgaaggcttcctggagatccttcaggtc
ccattccggttacaggagcatctggaccctgcgctgcagcgactatactgccagttttcc
gagggctga

DBGET integrated database retrieval system