KEGG   Rattus norvegicus (rat): 308918
Entry
308918            CDS       T01003                                 

Gene name
Ppfibp2
Definition
(RefSeq) PPFIA binding protein 2
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: SAM_1 SAM_2 DUF16 zf-C4H2 FxsA PKcGMP_CC
Other DBs
NCBI-GeneID: 308918
NCBI-ProteinID: NP_001094052
RGD: 1565383
Ensembl: ENSRNOG00000019667
UniProt: G3V9H6
Position
1q33
AA seq 876 aa
MTSDASHMLEAALEQMDGIIAGTKTAADFSDGTCEPGLSPPSSCLNSMPVLHLIEDLRLA
LEMLALPQEREALLSQIPGPTAAYIKEWFEDSLSQVNHHSAASNETYQERLARLEGDKES
LILQVSVLTDQVEAQGEKIRDLEVCLEGHQVKLNAAEEMLQQELLSRTSLETQKLDLMTE
VSELKLKLVGMEKEQKEQEEKQRKAEELLQELKHLKIKVEELENERNQYEWELKATKAEV
AQLQEQVALKDAEIERLHSQLSRSSALHSDHAERDQEIHRLKMGMETLRVANEDKDRRIE
ELTGLLNQYLRVKEIVMATQGSSERTLSINEDEIEGSFRKWNTTSKSPEEVMKQEVSPRC
SSPTPGPPPLPQKSLETRAQKKLSCSLEDLRCESGNKCINGNQTSPVGEPKDSSFLAEQK
YPTLPGKLSGATPNGEAAKSPPTASLQPDSSGSSQPKLRDTEGGWEDIVMTNELSSTSSG
TESSPQSPLTPDGKRSPKGIKKFWGKIRRTQSGNFNTDTPGMVEFRRGGLRATAGPRLSR
TRDTKGQKCDANAPFAQWSTERVCTWLQDFGLAQYVIFARQWVASGHTLLTATPQDMEKE
LGIKHPLHRKKLVLAVKAINTKQEEKSALLDHVWVTRWLDDIGLPQYKDQFYESRVDGRM
LQYLTVNDLLFLKVTSQLHHLSIKCAIHVLHVNKFNPNCLHRRPADESNLSPSEVVQWSN
HRVMEWLRSVDLAEYAPNLRGSGVHGGLIILEPRFTGDTLAMLLNIPPQKTLLRRHLTTK
FNALIGPEAEQEKRDKMASPAYTPLTTTAKVRPRKLGFSHFGNMRKKKFDESTDYICPME
PGDAVSDSHRVYGVYRGLSPLDNHELDGLDQVGQIS
NT seq 2631 nt   +upstreamnt  +downstreamnt
atgacttctgacgcgagtcatatgctggaagctgccttggagcagatggatgggatcatt
gcaggcactaaaacggctgcagattttagtgatggtacctgtgagcctgggctgtctcct
ccatcctcctgcttgaactccatgcctgtgctccatctcatcgaggacctgagactggcc
ttggagatgttggcacttcctcaggaaagggaagccctcctcagccagatccctggccca
acagctgcctacataaaggagtggtttgaggacagcttgtcccaggtaaatcaccacagt
gctgctagtaatgaaacctaccaggaacgcctggcacggctagaaggagataaagagtcc
ctcatattgcaggtgagcgtcctcacagatcaagtggaagcccaaggagagaagattcgg
gaccttgaagtgtgtctggaaggtcaccaggtgaaactcaatgccgcggaagagatgctt
cagcaggagctgctaagtcgcacatctctggagacccagaagttggatctgatgactgag
gtgtctgagctgaagctcaagctggttggtatggagaaagaacagaaagaacaggaggaa
aaacaaagaaaagcagaggagttactgcaagagctcaaacacctaaaaatcaaagtggag
gagctggagaacgaacggaaccagtatgagtgggagctgaaagccactaaggccgaggta
gcccagctgcaagaacaggtggccctaaaagatgcagaaatcgagcgtcttcacagccaa
ctctctcggagttcagctctccacagcgaccatgcagaacgagatcaagaaatccaccga
ctgaaaatgggaatggaaacactgcgggttgccaatgaggataaggaccgtcggatagag
gagctgacagggctgttgaaccagtacctaagggtaaaggagattgtgatggcaactcag
gggtcttcagagagaaccctctcaatcaatgaagatgaaatagagggaagcttccggaaa
tggaacactacaagtaaaagcccagaggaagtaatgaaacaagaggtatcgccacgatgc
agctctcccaccccagggccacctccattgccacagaaatcattggagaccagggctcag
aagaaactctcctgtagtctggaagacttgagatgtgaatctgggaataagtgtatcaat
gggaaccagacatccccggtgggagagcccaaggacagctctttcctagcagagcagaaa
taccccacgttacctgggaagctctcaggagccacacccaatggagaagctgccaaatct
cctcctactgcctccctccagcctgactcttcagggagcagccagccaaagctgagagac
acagaaggtggttgggaagatatcgtcatgaccaatgaactctcatctacttcatctggt
actgagtcaagcccccagtctcccctgacaccagatggcaaacggagccccaaaggcatt
aagaaattctggggaaaaatccgaagaactcagtcaggaaacttcaacactgatacaccg
ggtatggtggagtttcgacgaggtggtctccgggcaactgcagggccaagactttctagg
accagggacaccaagggacagaaatgtgatgccaatgccccctttgcccaatggagcaca
gaacgtgtatgtacatggctgcaggattttggcctggctcagtacgtgatctttgctaga
cagtgggtggcatctggccacacactactgacagctacccctcaggacatggaaaaggag
ctagggattaaacacccactccataggaagaagctggttttagcagtgaaagctatcaac
accaagcaagaagaaaagtctgcgctgcttgaccacgtttgggtgacacggtggcttgat
gatattggcttaccccaatacaaagaccagttttatgaatcaagagttgatgggcgaatg
ctgcaatacctaactgtgaatgatctactcttcttaaaagtcactagccaactacatcat
ctcagcatcaaatgtgctattcatgtgctacatgtcaacaagttcaaccccaactgcctg
cacaggagacctgctgatgagagtaacctttctccttcagaagtcgtgcagtggtccaac
cacagggtaatggagtggctgcgatccgtggacctggcagagtatgcacccaaccttcga
gggagtggcgtccacggtggcctcattatcctggagcctcgttttactggggacaccctg
gctatgcttcttaacatccccccacagaagacgctcctcaggcgccatctgaccaccaaa
ttcaatgccctgattggtcctgaggctgaacaggaaaagcgagataaaatggcctcacca
gcttacacaccgctgaccaccacagccaaagttcggcctaggaaactcggattttcacat
tttggaaacatgagaaaaaagaagtttgatgaatcaacggattacatttgccccatggag
cctggagatgctgtcagtgacagccacagggtctacggtgtctaccggggcctcagtccc
cttgataaccatgaactagatggtctggaccaggtgggacagataagctga

DBGET integrated database retrieval system