KEGG   Rattus norvegicus (rat): 309081
Entry
309081            CDS       T01003                                 

Gene name
Dock1
Definition
(RefSeq) dedicator of cytokinesis protein 1
  KO
K13708  dedicator of cytokinesis protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04510  Focal adhesion
rno04666  Fc gamma R-mediated phagocytosis
rno04810  Regulation of actin cytoskeleton
rno05100  Bacterial invasion of epithelial cells
rno05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    309081 (Dock1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    309081 (Dock1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    309081 (Dock1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    309081 (Dock1)
   05100 Bacterial invasion of epithelial cells
    309081 (Dock1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    309081 (Dock1)
Membrane trafficking [BR:rno04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    309081 (Dock1)
SSDB
Motif
Pfam: DOCK_N DHR-2 DOCK-C2 SH3_1 SH3_9 SH3_2 SR-25
Other DBs
NCBI-GeneID: 309081
NCBI-ProteinID: NP_001137330
RGD: 1566072
Ensembl: ENSRNOG00000018683
UniProt: D3ZZW1
Position
1
AA seq 1864 aa
MTRWVPTKREEKYGVAFYNYDARGADELSLQIGDTVHILETYEGWYRGYTLRKKSKKGIF
PASYIHLKEAIVEGKGQHETVIPGDLPLIQEVTTTLREWSTIWRQLYVQDNREMFRSVRH
MIYDLIEWRSQILSGTLPQDELKELKKKVTAKIDYGNRILDLDLVVRDEDGNILDPELTS
TISLFRAHEVASKQVEERLQEEKSQKQNMDINRQAKFAATPSLALFVNLKNVVCKIGEDA
EVLMSLYDPVESKFISENYLVRWSSSGLPKDIDRLHNLRAVFTDLGSKDLKREKISFVCQ
IVRVGRMELRDSNTRKLTSGLRRPFGVAVMDVTDIINGKVDDEDKQHFIPFQPVAGENDF
LQTVINKVIAAKEVNHKGQGLWVTLKLLPGDIHQIRKEFPHLVDRTTAVARKTGFPEIIM
PGDVRNDIYVTLVQGDFDKGSKTTAKNVEVTVSVYDEDGKRLEHVIFPGAGDEAISEYKS
VIYYQVKQPRWFETLKVAIPIEDVNRSHLRFTFRHRSSQDSKDKSEKIFALAFVKLMRYD
GTTLRDGEHDLIVYKAEAKKLEDAATYLSLPSTKGELEEKGHSATGKGMQSLGSCTISKD
SFQISTLVCSTKLTQNVDLLGLLKWRSNTNLLQQNLRQLMKVDGGEVVKFLQDTLDALFN
IMMENSESETFDTLVFDALVFIIGLIADRKFQHFNPVLETYIKKHFSATLAYTKLTKVLR
TYVASAEKPGINEQLYKAIKALEYIFKFIVRSRVLFNQLYENKGEADFVESLLQLFRSIN
DMMSSMSELTVRVKGAALKYLPTIVNDVKLVFDPKELSKMFTEFILNVPVGLLTVQKLYC
LIEIVHSDLFTQHDCREILLPMMTDQLKYHLERQEDLEACCQLLSNILEVLYRKDVGPTQ
RHVQIIMEELLRTVNRTVISMGRDSELIGNFVACMTAILRQMEDFHYAHLIKTFGKMRTD
VVDFLMETFIMFKNLIGKNVYPFDWVIMNTMQNKVFLRAINQYADMLNKKFLDQANFELQ
LWNNYFHLAVAFLTQESLQLENFSSAKRAKILNKYGDMRRQIGFEIRDMWYNLGQHKIKF
IPEMVGPILEMTLIPETELRKATLPIFFDMMQCEFHSTRSFQMFENEIITKLDHEVEGGR
GDEQYKVLFDKILLEHCRKHKYLAKTGETFVKLVVRLMERLLDYRTIMHDENKDNRMSCT
VNVLNFYKEIEREEMYIRYLYKLCDLHKECDNYTEAAYTLLLHAKLLKWSEDACAAHLIQ
RDGFQATTQGQLKEQLYQEIIHYFDKGKMWEEAIALGKELAEQYETELFDYEQLSELLKK
QAQFYENIVKVIRPKPDYFAVGYYGQGFPSFLRGKVFIYRGKEYERREDFEARLLTQFPN
AEKMKTTSPPGDDIKTSPGQYIQCFTVKPKLDLPPKFHRPVSEQIVSFYRVNEVQRFEYS
RPIRKGEKNPDNEFANMWIERTIYTTAYKLPGILRWFEVKSVFMVEISPLENAIETMQLT
NDKISSMIQQHLDDPGLPINPLSMLLNGIVDPAVMGGFANYEKAFFTDRYLQEHPEAHGQ
IEKLKDLIAWQIPFLAEGIRIHGDKVTEALRPFHERMEACFKQLKEKVEKQYGVRTMPSG
LDDRRGSRPRSMVRSFTMPSSSRPLSVASVSSFSSDSTPSRPGSDGFALEPLLPKKMHSR
SQDKLDKDDPDKEKKDKKKEKRNSKHQEIFDKEFKPADSSLQQSEAVILSETISPLRPQR
PKSQVINVIGSERRFSVSPASPCSQPTPPPVTPRAKLSFSIQPNLELNGMMGMDVADVPP
PLPLKGNMADYGNLMENQDLMGSPTSPPPPPQRQQPPPLPSKTPPPPPPKTTRKQTSVDS
GIVQ
NT seq 5595 nt   +upstreamnt  +downstreamnt
atgacgcgctgggtccccaccaaacgagaggagaagtacggcgtggctttttataactac
gatgccaggggagctgatgaattgtccttacaaataggagacacggtgcacatcctagaa
acttatgaagggtggtacagaggctacaccttaaggaaaaagtctaaaaagggtatattt
cctgcttcgtatattcatcttaaagaagccattgttgaaggaaaagggcagcatgaaact
gtcatccccggggacctccccctcatacaggaagtcaccacaacgctccgagagtggtct
accatctggagacaactttatgtgcaagataatagggagatgtttcgaagtgttcggcac
atgatctatgaccttattgagtggcggtcgcagattctttctggaactctgccccaggat
gagctcaaagagctgaagaagaaggtcacagccaaaatcgattatggaaacagaattctt
gatttggacttggtggtgagggatgaagatgggaacattttggatccggaactaactagc
accatcagtctcttccgagcacatgaagttgcttctaaacaagtagaagagagactgcaa
gaggagaaatctcaaaaacagaatatggatatcaacagacaagccaagttcgcagccacc
ccatctctggccttgtttgttaacctcaaaaatgtggtttgtaaaataggagaagatgcc
gaagtcctcatgtctctttatgaccctgtggagtccaaattcatcagtgagaactacctg
gtccgctggtcaagttcaggattaccaaaagacattgataggttacataacttgcgtgcg
gtgtttacggatctggggagcaaagacctgaaaagggagaaaattagtttcgtctgccag
attgtccgagttggtcgtatggagctgagggacagcaacacgaggaaactgacttcgggg
ctccggcgaccttttggcgtggctgtgatggacgtaacagacatcataaacgggaaagtg
gacgatgaagataaacagcacttcatccccttccagccggtggcaggggagaatgacttc
cttcaaactgtcataaacaaagtcattgcagccaaagaagtcaaccacaagggacaaggt
ttgtgggtaaccttgaaattacttcctggagacatccatcagattcggaaggagtttcct
cacttggtggacaggaccacagctgtggcccgcaagactgggtttccagagatcatcatg
ccaggtgatgttcgaaatgatatctatgtgacattagttcaaggggattttgataaaggc
agtaaaacaaccgcgaagaatgtggaggtgacggtgtctgtctatgatgaagatgggaag
cgattggagcacgtgatcttccccggtgctggcgacgaggccatctctgagtacaaatca
gtgatttattaccaagtgaagcagcctcgttggttcgagacccttaaggtggccatcccc
atcgaggacgtgaaccggagtcaccttcgatttaccttccgccatagatcctctcaggac
tccaaggataaatctgagaagatcttcgcactggcctttgtgaagctgatgagatatgat
gggaccaccctgagagacggggagcatgaccttattgtctacaaggctgaagccaaaaag
ctggaagacgctgccacatatttgagcctccctagtaccaagggagagttggaagaaaag
ggccactcagccacaggcaaaggaatgcagagtcttgggagttgcaccatcagtaaagat
tctttccagatctctacgctggtgtgctccaccaaactgacccagaatgtggacctcctg
gggctgttgaagtggagatccaacaccaaccttctgcagcagaacttgagacagttgatg
aaggtggatggtggcgaagtggtaaagttcctgcaggacaccttggatgccctcttcaac
atcatgatggagaactccgagagtgagacgtttgataccttggtgtttgatgcgctggtc
tttatcattggactaatcgcggataggaagtttcagcattttaatcctgttttggagact
tacattaagaaacacttcagtgcgacattagcctacacgaaactgaccaaggtgttaagg
acttatgtggccagcgctgaaaaaccgggaatcaacgagcagctgtacaaagccataaaa
gccttggagtacatcttcaagttcatagtgcgctcacgggtactgttcaaccagctgtat
gaaaacaagggggaggccgacttcgtggagtccttgttgcaactgttccggtccatcaac
gacatgatgagcagcatgtcggagctcacagtcagggtgaagggggcagcattgaagtac
ttgccaacaattgtcaatgatgtgaagttggtgtttgatcccaaagagctcagtaaaatg
ttcacggaattcatcttgaatgttcctgtgggcttgctgactgtccagaagctctactgc
ctgattgagattgttcacagtgatctcttcacacagcatgactgcagagagatcctgctc
cccatgatgacggatcagctcaagtaccacctagagaggcaggaggatctggaggcatgc
tgccagctgcttagcaacatcctggaggtgctataccggaaagatgtgggcccgactcag
agacacgtccagatcatcatggaggagcttctcaggactgtgaacaggacggtcatttcc
atggggcgggattccgaactcattgggaactttgtggcttgcatgacagctattttacgg
cagatggaagacttccattatgcacacctgatcaagaccttcgggaaaatgaggacagac
gtcgtggattttctgatggagacattcatcatgtttaagaacctcatcgggaagaatgtc
tacccctttgactgggtgataatgaacacgatgcagaacaaagttttcctgcgggcgatt
aatcagtatgcagatatgctgaacaagaaatttctggatcaagccaactttgagctgcag
ctgtggaacaattactttcacctggccgtggctttcctcactcaagagtccctgcaactg
gagaatttttcaagtgctaagagagccaaaatccttaacaagtatggagacatgaggagg
cagattggctttgagatcagagacatgtggtacaacttgggtcaacacaagataaaattc
atcccagaaatggttggccctatattggaaatgacattgattcctgagacagaacttcga
aaagccacccttcccatcttcttcgacatgatgcagtgtgaattccactccacccggagc
ttccaaatgtttgaaaatgagatcatcactaagctggatcatgaagtggaaggaggcaga
ggagacgagcaatacaaagtgttatttgataaaatcctcctggagcactgcaggaagcat
aaatacctggccaagacaggagaaacttttgtgaagctcgtggtgcggttgatggagaga
ctcctggactacaggaccatcatgcacgacgaaaacaaagacaatcgtatgagctgcaca
gtcaacgtgctgaatttctacaaagagattgaaagagaagagatgtatataaggtacttg
tataagctctgcgacctgcacaaagagtgtgacaactacacagaggcggcttacaccttg
cttctgcatgcgaagcttctaaagtggtcagaggatgcgtgtgcagctcacctcattcag
cgggacgggttccaggcgacaacacagggacagctgaaagaacagctctaccaagaaatc
atccactattttgacaaaggcaagatgtgggaggaggccatcgccctgggcaaggaactt
gcagagcagtacgaaacggagttgtttgattatgagcagctgagtgagttgctgaaaaaa
caggcacaattttatgagaacatcgtcaaggtgataagacccaagccggactattttgct
gttggctactatgggcaaggcttcccttcattccttcggggaaaagtgttcatttaccga
ggaaaagaatacgagcgacgggaagattttgaagctcggctattaactcagtttccaaat
gctgagaaaatgaagacgacatctccacccggcgatgacattaagacttctccaggccag
tacattcagtgcttcacagtgaagcccaagctagatttgccccctaagtttcaccggcca
gtgtctgaacagattgtcagtttttacagggtgaatgaggtccagcgatttgaatattca
cggcccatccggaaaggagaaaaaaacccagacaatgaatttgcgaatatgtggatcgag
agaaccatctacaccacagcctataaactgccgggaattttaaggtggtttgaagtcaaa
tctgtcttcatggtagagatcagtccactggagaatgccatcgagacgatgcagctgacc
aatgacaagattagcagcatgatccagcagcacctggatgacccaggcctgcctatcaac
cctctgtccatgctcctgaatggcattgtggatcctgctgtcatgggaggctttgccaat
tatgagaaggctttcttcacagaccgatacctgcaggagcatcctgaggcccatgggcag
atcgagaagctcaaggacctgatagcctggcagattccatttttggctgaagggatcagg
attcatggagacaaagtcacagaggccctgaggccattccatgagcgcatggaagcctgt
ttcaagcagctgaaggaaaaagtggaaaagcaatatggcgtcaggaccatgccctcaggc
ttggatgacaggagaggcagtcgtcctcggtccatggtgcggtccttcacaatgccatca
tcctctcggccactgtcagtggcttctgtctcttctttctcctctgacagcaccccttca
aggccaggctctgatggatttgctctcgagcctctgctgccgaagaagatgcactccagg
tcccaggacaagctagacaaggacgatccagataaagagaagaaggacaagaagaaggag
aaaaggaacagcaaacaccaagagatatttgataaggaattcaagcctgctgacagctcc
ctgcagcagtctgaggctgtgatcctgtctgaaacgataagtcccctgcgaccccaaaga
cccaagagccaggtgatcaatgtcattggaagcgaaagacgcttctctgtgtctccagct
tcaccgtgctcccagccgacaccccctccagtcacaccaagagccaagctcagcttcagc
attcagcccaatctggagctgaatggcatgatggggatggatgtggccgatgtcccaccc
cctctgcccctcaaaggcaacatggcagattatggaaatctgatggaaaaccaggatttg
atgggctcacccacatctcctcctcctcccccacagcggcaacagccacctccactgccc
agcaaaacaccacctcctccccctccgaagacgacccgaaagcagacctcagtggactct
gggatcgtgcagtga

DBGET integrated database retrieval system