KEGG   Rattus norvegicus (rat): 309126Help
Entry
309126            CDS       T01003                                 

Gene name
Tnpo1
Definition
(RefSeq) transportin 1
  KO
K18752  transportin-1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    309126 (Tnpo1)
   03009 Ribosome biogenesis [BR:rno03009]
    309126 (Tnpo1)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     309126 (Tnpo1)
Ribosome biogenesis [BR:rno03009]
 Eukaryotic type
  Pre-40S particles
   Export and cytoplasmic maturation factors
    309126 (Tnpo1)
  Pre-60S particles
    309126 (Tnpo1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HEAT_EZ HEAT HEAT_2 Arm IBN_N Cnd1 Vac14_Fab1_bd Adaptin_N UNC45-central CLASP_N Dopey_N MMS19_C RTP1_C1 DUF3689 Urb2
Motif
Other DBs
NCBI-GeneID: 309126
NCBI-ProteinID: NP_001094162
RGD: 1308372
Ensembl: ENSRNOG00000014999
UniProt: F1LQP9
Position
2q12
AA seq 890 aa AA seqDB search
MEYEWKPDEQGLQQILQLLKESQSPDTTIQRTVQQKLEQLNQYPDFNNYLIFVLTKLKSE
DEPTRSLSGLILKNNVKAHFQNFPNGVTDFIKSECLNNIGDSSPLIRATVGILITTIASK
GELQNWPDLLPKLCSLLDSEDYNTCEGAFGALQKICEDSAEILDSDVLDRPLNIMIPKFL
QFFKHSSPKIRSHAVACVNQFIISRTQALMLHIDSFIENLFALAGDEEAEVRKNVCRALV
MLLEVRMDRLLPHMHNIVEYMLQRTQDQDENVALEACEFWLTLAEQPICKDVLVRHLPKL
IPVLVNGMKYSDIDIILLKGDVEEDEAIPDSEQDIRPRFHRSRTVAQQHEEDGIEEDDDD
DDEIDDDDTISDWNLRKCSAAALDVLANVYRDELLPHILPLLKELLFHHEWVVKESGILV
LGAIAEGCMQGMIPYLPELIPHLIQCLSDKKALVRSITCWTLSRYAHWVVSQPPDTYLKP
LMTELLKRILDSNKRVQEAACSAFATLEEEACTELVPYLAYILDTLVFAFSKYQHKNLLI
LYDAIGTLADSVGHHLNKPEYIQMLMPPLIQKWNMLKDEDKDLFPLLECLSSVATALQSG
FLPYCEPVYQRCVNLVQKTLAQAMLNNAQPEQYEAPDKDFMIVALDLLSGLAEGLGGNIE
QLVARSNILTLMYQCMQDKMPEVRQSSFALLGDLTKACFQHVKPCIADFMPILGTNLNPE
FISVCNNATWAIGEISIQMGIEMQPYIPMVLHQLVEIINRPNTPKTLLENTAITIGRLGY
VCPQEVAPMLQQFIRPWCTSLRNIRDNEEKDSAFRGICTMISVNPSGVIQDFIFFCDAVA
SWINPKDDLRDMFCKILHGFKNQVGDENWRRFSDQFPLPLKERLAAFYGV
NT seq 2673 nt NT seq  +upstreamnt  +downstreamnt
atggagtatgagtggaaacctgacgagcaagggcttcagcagattctgcagctgctcaag
gagtcccagtccccagacaccaccatccagaggaccgtgcaacaaaaactggaacaactt
aatcaatatccagattttaacaactacttaatttttgttcttacaaaattaaaatctgaa
gatgagcccacacggtcattgagcggtctgatcttgaagaacaatgtgaaagctcatttt
cagaacttcccgaacggtgtgacggacttcatcaagagtgaatgtctaaataatattggg
gactcctctccgctgatcagggccactgttggtattttaattacgaccatagcctccaag
ggagaactgcagaattggcctgacctcttaccaaaactctgtagcctgctggattctgaa
gactacaacacctgtgagggggcattcggtgcccttcagaagatatgtgaggactccgcg
gagattttagacagcgatgtcttggatcgccctctcaacatcatgatccccaagttctta
cagtttttcaagcacagtagtcccaaaataaggtctcacgctgttgcatgtgtcaatcag
ttcatcatcagtcggacccaagcgctcatgttgcacatcgactccttcattgagaacctc
tttgcactggctggtgacgaggaagccgaggtgcggaagaacgtgtgccgagcgcttgtg
atgctgctggaagtccggatggaccgtctgctgccgcacatgcataacatagtcgagtac
atgcttcagaggacccaagaccaagatgagaatgtggctctggaggcctgtgaattctgg
ctgactttggctgaacagccaatatgcaaagatgtacttgtaaggcatctgcctaagttg
attcccgtgttagtgaatggcatgaagtactcagatatagacatcatcctgctgaagggg
gatgttgaagaagacgaggccatccctgatagtgagcaggatatacggccacggttccat
cgctcaaggacggtggctcagcagcatgaagaggatgggattgaagaggatgacgacgac
gacgatgagattgatgatgacgataccatttctgactggaatctcagaaagtgttctgct
gctgctctcgatgttctcgcaaacgtttatcgtgatgagcttttgccacacattttgcca
cttttgaaagaattgcttttccatcacgagtgggttgtgaaagagtctggcatcttggtt
ttaggagcaattgctgaaggttgcatgcaaggcatgattccgtacctgcccgagctcatt
cctcacctcattcagtgcctttctgacaaaaaggctcttgtgcgttccatcacctgctgg
actctaagccgctatgcacactgggtagtcagccagccaccagatacatacctgaagcca
ttaatgacggaattgctgaagcgtatcctggatagcaacaagagagtacaagaagctgct
tgcagtgcctttgctacgttagaagaggaggcttgtacagagcttgtcccctaccttgct
tatatactcgacaccctcgtcttcgccttcagtaaataccagcacaagaacctgctcatt
ctgtacgatgccatagggacactagcagattcagtgggacatcatttaaacaagccagaa
tatattcagatgctaatgcctcctctgatccagaagtggaacatgttaaaagatgaagac
aaggatcttttccctttacttgagtgcctctcatctgttgccacagccttgcagtctggt
ttccttccatattgtgaacctgtgtatcagcgttgtgtaaacctggtacagaagacacta
gcacaagccatgctaaacaatgctcagccagaacaatatgaagctccagataaagacttt
atgattgtggctcttgacttactcagtggcctggctgaaggactgggaggcaacattgag
cagctggtggcccgaagtaacatcctgacactgatgtatcaatgcatgcaggataaaatg
cccgaagttcggcagagttcttttgcattactaggtgatctgactaaagcttgctttcag
cacgttaagccttgtatagctgatttcatgccaatattgggaaccaatctaaatccagag
tttatttcagtctgcaacaacgccacctgggcaattggggaaatatcaattcaaatgggc
atagagatgcagccttacatccctatggtgctgcaccagctcgtggagatcattaacaga
cccaacaccccaaagacgctgttggagaacacagcaataacaattggtcgtcttggttac
gtttgtcctcaagaggtggcccccatgctacagcagtttataagaccctggtgtacctct
ctgagaaacataagagacaatgaagaaaaagattcagcattccgtgggatttgtaccatg
atcagtgtgaatcctagtggcgtaatccaagattttatatttttttgtgatgctgttgca
tcatggattaatcccaaagacgacctcagagacatgttctgtaagatccttcatggattt
aaaaaccaagttggggatgaaaattggaggcgattctctgaccagtttcctcttccctta
aaagagcgtcttgcggctttttatggtgtttaa

DBGET integrated database retrieval system