KEGG   Rattus norvegicus (rat): 309887
Entry
309887            CDS       T01003                                 

Gene name
Ascc3
Definition
(RefSeq) activating signal cointegrator 1 complex subunit 3
  KO
K18663  activating signal cointegrator complex subunit 3 [EC:3.6.4.12]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rno03400]
    309887 (Ascc3)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     309887 (Ascc3)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   Direct repair
    309887 (Ascc3)
SSDB
Motif
Pfam: Sec63 DEAD ResIII Helicase_C AAA_22 Helicase_PWI AAA_19 PhoH DUF1801
Other DBs
NCBI-GeneID: 309887
NCBI-ProteinID: NP_001263986
RGD: 1307995
Ensembl: ENSRNOG00000037604
UniProt: A0A0A0MY43
Position
20
AA seq 2201 aa
MALPRLTGALRSFSNVTKQDNYNEEVADLKLKRSKLHEQALDFGLSWKKIVKFLNEKLEK
NKMQTINEDLKDILQAAKQIVGTDNGNEAIESGAAFLFMTFHMTDSVGYTETKAIRQMFG
PFPSSSATSACNATSRIISHFSQDDLTALVQATENQCNDRVVFGRNLAFSFDMHDLDHFD
ELPVNGEAQKTISLDYKKFLNEQFQEPYTPELKPVEKSNGSLLWCEVEKYLNATLKEMTE
APRVEDLCCTLYDMLASAKSGDELQDELFELLGPGGLDLIEKLLQNRITIVDRFLNSSSD
HKFQVLQDNCKKILGENAKPNYGCQVTIQSEQEKQLMKQYRREEKRIARREKKAGEDGEV
SGEGLLPFDPKELRLQREHALLNARSAPILGRQRDTEVEKIRYPHVYDSQAAARETSAFI
AGAKMILPEGIQRENTKLYEEVRIPYSEPMPVGFEEKPVYIQDLDEVGQLAFKGMKRLNR
IQSIVFDTAYNTNENMLICAPTGAGKTNIAMLTVLHEIRQHFHQGVLKKNEFKIVYVAPM
KALAAEMTNYFSKRLEPLGIVVKELTGDMQLSKSEILRTQMLVTTPEKWDVVTRKSVGDV
ALSQIVKLLILDEVHLLHEDRGPVLESIVARTLRQVESTQSMIRILGLSATLPNYLDVAT
FLHVNPYIGLFYFDGRFRPVPLGQTFLGIKSANKMQQLNNMDEVCYESVLKQVKAGHQVM
VFVHARNATVRTAMSLIERAKNSGQISCFLPTQGPEYGHALKQVQKSRNKQVRELFSDGF
SIHHAGMLRQDRNLVENLFSNGHIKVLVCTATLAWGVNLPAHAVIIKGTQIYAAKRGSFV
DLGILDVMQIFGRAGRPQFDKFGEGIIITTHDKLSHYLSLLTQQNPIESQFLESLADNLN
AEIALGTVTNVEEAVKWMSYTYLYVRMRANPLAYGISHKAYQMDPTLRKHREQLLIEVGQ
KLDKARMIRFEERTGYFSSTDLGRTASHYYIKYNTIETFNELFDAHKTEGDIFAIVSKAE
EFDQIKVREEEIEELDALLNNFCELSAPGGVENSYGKINILLQTYISRGEMDSFSLISDS
AYVAQNAARIVRALFEIALRKRWPTMTYRLLNLSKVIDKRLWGWASPLRQFSVLPPHILT
RLEEKNLTVDKLKDMRKDEIGHILHHVNIGLKVKQCVHQIPSVTMEASIQPITRTVLRVS
LNIYPDFSWNDQVHGTVGEPWWIWVEDPTNDHIYHSEYFLALKKQVINKEAQLLVFTIPI
FEPLPSQYYIRAVSDRWLGAEAVCIINFQHLILPERHPPHTELLDLQPLPVTALGCKAYE
ALYNFSHFNPVQTQIFHTLYHTDCNVLLGAPTGSGKTVAAELAIFRVFNKYPTSKAVYIA
PLKALVRERMDDWKIRIEEKLGKKVIELTGDVTPDMKSIAKADLIVTTPEKWDGVSRSWQ
NRSYVQQVNILIIDEIHLLGEERGPVLEVIVSRTNFISSHTEKPVRIVGLSTALANARDL
ADWLNIKQMGLFNFRPSVRPVPLEVHIQGFPGQHYCPRMASMNKPAFQAIRSHSPAKPVL
IFVSSRRQTRLTALELIAFLATEEDPKQWLNMDEQEMENIIATVRDSNLKLTLAFGIGMH
HAGLHERDRKTVEELFVNCKVQVLIATSTLAWGVNFPAHLVIIKGTEYYDGKTRRYVDFP
ITDVLQMMGRAGRPQFDDQGKAVILVHDIKKDFYKKFLYEPFPVESSLLGVLSDHLNAEI
AGGTITSKQDALDYITWTYFFRRLIMNPSYYNLGDVSQDAINKFLSHLIGQSLVELELSH
CIEVGEDNRSIEPLTCGRIASYYYLKHKTVKMFKDRLKPECSTEELLSILSDAEEYTDLP
VRHNEDHTNNELAKCLPIELNPHSFDSPHTKAHLLLQAHLSRAMLPCPDYDTDTKTVLDQ
ALRVCQAMLDVAASQGWLVTTLNITHLIQMVIQGRWLKDSSLLTIPNIEQHHLHLFRKWK
PPVKGPHAKCRTSIECLPELIHACEGKEHVFSSMVEKELQPAKTKQAWNFLSHLPVINVG
ISVKGSWDDSVEGHNELSISTLTADKRDENTWIKLHADQQYVLQVSLQRVHFEFHKVKHE
SHAVTPRFPKLKDEGWFLILGEVDKRELVAVKRVGFVRTHHEASISFFTPEAPGRYIFTL
YLMSDCYLGLDQQYDIFLNVTKADISTQINTEVPDVSTDLA
NT seq 6606 nt   +upstreamnt  +downstreamnt
atggctttacctcgcctcacaggagccttgcgctccttttcaaatgtcaccaagcaagat
aattataatgaagaagtagctgacttaaagctgaagcgatccaaacttcatgaacaagct
ttagatttcggcctttcatggaagaagatagtgaagtttttgaatgaaaaactagaaaag
aataaaatgcaaactataaatgaagacttaaaagatatactacaagctgcaaaacaaatc
gttggaacggataatgggaatgaagcaattgaaagtggggctgcattcctctttatgacg
tttcacatgacagactctgttggttacacggagacaaaggctatcagacagatgtttgga
ccctttccatcatcctctgctacctcagcttgtaatgccactagtcggattatttcgcat
tttagtcaagatgatctcactgctttagtccaggcgacagaaaaccaatgtaatgataga
gtggtctttggtagaaacttagcattttcctttgacatgcatgatctggaccactttgat
gaattaccagtaaatggtgaagcccagaaaactataagcttagactacaagaagttcctg
aatgaacagtttcaggaaccctacaccccagaactcaagcccgtggaaaaatcaaatggc
tccttattgtggtgtgaagtagagaagtacttaaacgcaactctaaaggaaatgactgaa
gcaccaagagttgaagatctgtgctgtacgttatatgacatgcttgcttctgctaaaagc
ggggatgagcttcaggatgagctttttgaattgctgggacctggaggacttgatttgatt
gagaagctactccagaacagaattacaatcgtagatcgatttcttaattcctcaagtgat
cataagttccaagttcttcaagataattgtaaaaaaattttaggagagaatgcgaagcct
aattatggttgtcaagtcacgattcagtccgaacaagaaaagcagttaatgaaacagtat
cggcgtgaggaaaaaagaattgccaggagagaaaagaaggctggggaagatggggaagtt
tctggagaaggacttttgccctttgatcctaaggaactccgattacagagagaacatgcg
cttctgaatgctagaagtgctccaattttgggaaggcagagagacacggaggttgagaaa
attcgttatcctcatgtttatgattcccaggctgcagcccgagaaacatcagcatttata
gctggggccaagatgattttgccagaaggcatccagagagagaataccaagctgtatgaa
gaagtaaggatcccctatagtgaaccaatgcccgttgggtttgaggagaaaccagtttat
atccaggatttagatgaggtgggacagttggcttttaaaggaatgaagagactcaataga
atccagtctatagtatttgacacagcctacaacaccaacgaaaacatgctcatctgtgcc
cctactggagctgggaagaccaatattgcaatgctcactgtcttacatgaaatccgccaa
cactttcaccaaggtgttcttaaaaagaatgagtttaagattgtgtatgttgctccaatg
aaagccttggcagctgaaatgacgaattacttcagcaaacgtctagagccactgggcatt
gttgtgaaagaattgactggagatatgcagttgtcaaaaagtgaaattctacgaactcag
atgcttgtgaccacaccagaaaaatgggatgtagtaacaagaaagagtgttggggatgtt
gctctttcccaaattgtaaaactcctgattctcgatgaggttcacttgctgcatgaagac
agaggcccagtgctagaaagcatagttgcgaggaccttacggcaggttgaatccacacag
agtatgataagaatccttggcttatctgcaaccttgcccaactacctggatgttgctaca
tttttacatgttaacccctacattggtcttttctactttgatggccgttttcgacctgta
cctctgggacagacatttttagggattaaaagtgcaaataagatgcagcagttaaataac
atggatgaagtgtgctacgaaagcgttctgaagcaagtaaaggctggacaccaggtgatg
gtatttgtacatgctcgaaatgccactgtaaggacagctatgtctctaatagagagagca
aaaaacagtggccagatctcctgttttctccccacccaaggaccagagtatgggcatgca
ttgaaacaggtacaaaagtcaagaaataagcaagtgcgagagttattctcagatggcttt
agcattcatcatgccgggatgcttcggcaagacagaaatttggttgaaaatttgttctca
aatgggcacatcaaagtcctggtttgcacagccaccctagcctggggtgtcaatctccct
gcacatgccgtcattattaagggaacacaaatctatgctgccaaaagaggctcctttgtt
gaccttggaattttagatgtcatgcagatatttggccgagccggacgaccgcaatttgac
aaatttggggaaggaatcattataaccacacatgataaactcagccattacctcagtttg
ctcactcaacaaaacccgattgagagtcagtttctggaaagtcttgcagataacctaaat
gcagagattgcactaggaacagtcaccaatgtggaagaggcggtgaagtggatgagttac
acgtacctctacgtgcggatgagagcaaacccactcgcctacggcatcagtcacaaagca
taccagatggacccaacgttaagaaagcaccgagaacagctcctcattgaagttggacaa
aagctggataaagctaggatgattcgctttgaagaacgaactggctatttttcttccact
gatttgggtagaactgccagccactactatattaaatacaacaccattgagacattcaat
gaactctttgatgcacacaaaacagaaggtgatatctttgctattgtctccaaagctgaa
gaatttgatcaaattaaggtcagagaagaagaaatagaagaattagatgccttgttaaac
aatttctgtgaactctcagctccaggaggtgtggaaaatagttatgggaaaataaacatc
ctacttcagacctacatcagccgaggagagatggacagtttctccctcatatcagattcc
gcatatgttgcccagaatgcagctagaattgtccgtgctctctttgaaattgcactgagg
aaacgttggcctaccatgacctacaggcttttgaatcttagtaaagtcattgacaagaga
ctctggggttgggctagccctttgagacaattttctgtgttaccaccacacatcctaaca
agattagaagaaaaaaaccttacagtggataaactcaaagacatgagaaaagatgaaata
ggtcacattttgcatcatgtgaatattggactgaaggtcaaacagtgtgttcatcagatt
ccttctgttacaatggaagcttccattcagcccatcacacggactgtcctccgagtctca
ctgaacatctaccctgatttctcttggaatgatcaggtccatggcacagtaggggaaccg
tggtggatctgggtagaagatcctacaaacgaccatatttatcactcggagtactttcta
gctcttaaaaaacaggttattaataaagaagctcaacttctggtatttacaatccctatt
tttgagcctttgccctctcagtactacattcgagcagtatctgatagatggctaggagct
gaagctgtttgcattatcaactttcaacatctgattctaccagagagacatcctccccat
acagaattattggaccttcagcctttgccagtcacagccttggggtgcaaagcatatgaa
gctctgtataacttcagccacttcaacccggtgcagacacagatattccacacgctgtat
cacactgactgtaacgtcctacttggagcccccacggggtcaggaaagacagttgcagct
gaactcgccattttcagagtcttcaacaagtatcccacttccaaggcagtatatattgca
cccctcaaagctctagtacgtgaaagaatggatgattggaaaattagaatagaagaaaaa
cttggtaaaaaagttattgaactgactggggatgtgactccagacatgaaatccattgct
aaggctgaccttatcgtcactacaccagaaaagtgggatggcgtcagtcgaagctggcag
aacaggagctacgttcagcaggtcaacattctcatcatagatgagatccacctgctaggt
gaggagagaggtccagttctagaagtcattgtatctcgaacaaactttatctcatcgcac
acagagaagcctgttagaatagtcggactgtccactgccttagccaatgctagagacctt
gctgactggctcaacattaagcagatgggtttgtttaacttccgaccttctgtgcgccct
gttccactggaagttcacattcaaggtttcccaggacaacattactgcccacgcatggct
agtatgaacaagcctgcattccaggcaattagaagtcattctccagccaaacctgttttg
atatttgtctcctcaagacgtcaaacacggcttacggctttagagttgatagctttcctg
gccactgaagaagacccaaagcagtggttaaacatggacgagcaagagatggagaacatc
attgcaacagtgcgagattccaaccttaagctgactctagcttttggaataggaatgcat
catgctggactacatgaaagagaccgaaaaactgtggaagagctgtttgtgaactgtaaa
gtgcaggttctcattgcgacaagcacgttagcatggggtgtaaactttccagcacactta
gtcattattaagggaactgaatactacgatggaaagacaagacgctatgtggatttcccc
atcacagatgtactgcagatgatggggcgagctgggagacctcagtttgatgaccagggc
aaagctgtaattctagttcatgatataaaaaaggatttttataaaaagtttctttatgaa
cctttcccagtggaatcgagcttattaggagtgttgtctgaccacttaaatgcagagatt
gcgggaggtacaataacatcaaagcaagatgccttggattatatcacttggacttacttt
ttccgacgtcttatcatgaatcccagctactacaacttgggggacgtcagccaggacgcc
ataaacaagttcctgtcacatctgattgggcaatctctggttgagttggagctttcccac
tgcattgaagttggagaggacaatcgcagcattgaaccactgacatgtggccgaattgcc
tcctattactatctgaagcacaagacagtcaaaatgttcaaggaccgtttaaagcctgag
tgcagcactgaagaattgctgtcaattctaagtgatgcggaagaatacacagacttgcca
gtaagacacaatgaggaccatacgaataatgaactggccaaatgtcttcccattgaatta
aatcctcattcatttgacagccctcacaccaaagcccatctcttgcttcaagcacatctc
agccgagccatgctgccctgcccagactatgatactgataccaaaacagtcttagatcaa
gctctcagagtatgccaggcaatgctggatgtggctgcaagccaaggatggctagtgact
accctgaatatcacccacctgattcagatggtgatccaaggccgatggctaaaggactcg
tctcttcttaccataccaaacatagaacagcaccatcttcaccttttcaggaagtggaaa
ccacctgtaaagggcccacatgctaagtgccgaacatccattgagtgccttcctgagctg
atccatgcctgtgaagggaaggagcatgtgttcagctccatggtagagaaggagttacag
cctgcgaaaacaaagcaggcatggaatttcttatctcacttgcccgtgataaatgttggc
ataagtgttaaaggctcctgggatgactcagttgaaggacataatgaactctccatctca
actctgacagcagacaaacgggatgaaaacacatggatcaagttgcatgctgatcagcag
tatgtgcttcaagtcagcctacagagagtccattttgagttccacaaggtaaaacatgag
agtcacgcagttactcctcgatttccaaaattaaaagatgaagggtggtttttgatatta
ggagaagtggataagagagagctggtggctgtaaaacgcgtaggatttgttcgaactcat
cacgaggcttccatctctttctttactccggaagcacctggaagatatatctttaccctg
tatctcatgagtgactgttacctcggcctagaccagcagtatgacatctttctcaatgtc
acaaaagcagacatctccacccagatcaacacagaagtccctgatgtctcaactgacttg
gcataa

DBGET integrated database retrieval system