KEGG   Rattus norvegicus (rat): 310090Help
Entry
310090            CDS       T01003                                 

Gene name
Ddx4, RVLG
Definition
(RefSeq) DEAD-box helicase 4
  KO
K13982  probable ATP-dependent RNA helicase DDX4 [EC:3.6.4.13]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    310090 (Ddx4)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     310090 (Ddx4)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Gene silencing
   piRNA pathway
    310090 (Ddx4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEAD Helicase_C ResIII
Motif
Other DBs
NCBI-GeneID: 310090
NCBI-ProteinID: NP_001071115
RGD: 1308793
Ensembl: ENSRNOG00000026686
UniProt: Q64060
Position
2q14
AA seq 713 aa AA seqDB search
MGDEDWEAEILKPHVSSYVPVFEKDKYSSGANGDTFNRTSASSSEMEDGPSGRDHFMRSG
FSSGRNLGNRDIGESSKRETTSTTGGFGRGKGFGNRGFLNNKFEEGDSSGFWKESTNDCE
DTQTRSRGFSKRGGYPDGNDSEASGPFRRGGRDSEYDQDQGSQRGGGLFGSRKPAASDSG
SGDTFQSRSGNARGAYKGLNEEVVTGSGKNSWKSEAEGGESSDIQGPKVTYIPPPPPEDE
DSIFAHYQTGINFDKYDTILVEVSGHDAPPAILTFEEANLCQTLNNNIAKAGYTKLTPVQ
KYSIPIVLAGRDLMACAQTGSGKTAAFLLPILAHMMRDGITASRFKELQEPECIIVAPTR
ELINQIYLEARKFSFGTCVRAVVIYGGTQFGHSIRQIVQGCNILCATPGRLMDIIGKEKI
GLKQVKYLVLDEADRMLDMGFGPEMKKLISCPGMPSKEQRQTLLFSATFPEEIQRLAGEF
LKSNYLFVAVGQVGGACRDVQQSILQVGPVFKKRKLVEILRNIGDERPMVFVETKKKADF
IATFLCQEKISTTSIHGDREQREREQALGDFRCGKCPVLVATSVAARGLDIENVQHVINF
NLPSTIDEYVHRIGRTGRCGNTGRAISFFDTESDNHLAQPLVKVLSDAQQDVPAWLEEIA
FSSYAPPSFSNSTRGAVFASFDTRKNFQGKNTLNTAGISSAQAPNPVDDESWD
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atgggagatgaagattgggaggcagaaatcctcaaacctcatgtgtcttcctacgttcct
gtatttgagaaggataaatattcttctggggcaaatggagacacttttaacaggacttca
gcttcatcatcagaaatggaagatggaccttctggaagagatcatttcatgagaagtgga
ttttcctctggaagaaatttaggaaacagagatattggcgagtctagtaaaagagagact
acatctacaaccggtggctttggaagaggaaagggttttggaaacagaggttttttaaat
aacaagtttgaagaaggtgacagctctggtttctggaaagagtctactaatgactgtgaa
gatactcagactcggagcagagggttttccaagcgaggcggctatccagatgggaatgat
tcggaagcttcaggcccattcagaagaggtgggagagatagtgaatatgaccaagatcag
ggatcacagcgtggtggtggcctttttggttctaggaaaccagcagcaagtgattcaggc
agtggtgacactttccagagcagaagtgggaatgcccgaggtgcctacaaaggcttaaat
gaagaagtagtaacaggctctggaaagaattcttggaagtcagaagctgaaggaggcgaa
agcagtgatattcaaggtccaaaagtgacatatataccccctcctccaccagaggatgag
gactccatctttgcacattatcagacaggcataaactttgataaatatgataccatactt
gttgaagtatctggacatgatgcaccaccggcaattttgacttttgaagaagcgaatctc
tgccagaccctgaataacaacattgctaaggctggctataccaagctcactcctgtgcag
aagtacagcattcccattgtgttagcaggaagagatttgatggcttgtgctcaaacaggg
tctgggaagacggcagcttttctcttgcctattttggctcatatgatgagggatggaata
actgccagtcgctttaaagaactgcaggaaccagagtgtattattgtagcaccaactcga
gaattgatcaaccaaatttatttggaagccagaaaattttcttttgggacttgtgtaaga
gctgttgtcatatatggaggaacccagtttgggcactcaattcgacagatagtgcaaggg
tgtaatatattatgtgctactccagggaggctgatggatatcataggcaaagaaaagatt
ggtctcaaacaagtcaagtacttagttttggatgaagctgatcgaatgttggatatgggt
tttggacccgaaatgaagaagttaatttcttgtccaggaatgccatcaaaggaacagcgc
caaactctcttattcagtgcaacttttccagaagaaatccagaggttggctggcgagttt
ttaaagtcaaattatttgtttgttgctgttggacaagtgggaggagcttgcagagatgtg
cagcagtccattcttcaagttggcccagtattcaaaaagagaaaacttgttgagattcta
cgaaacataggtgatgaaagacctatggtctttgttgaaaccaagaaaaaagcagatttc
attgcgactttcctttgtcaagaaaaaatatcaactacaagtattcatggcgatcgggaa
cagagggagcgagaacaagctcttggagattttcgctgtggaaagtgcccagttcttgtt
gctacttcagtggctgccagaggacttgatattgaaaatgttcaacatgttatcaatttt
aaccttccttctaccattgatgaatatgttcatcgaattggacgtactggacgttgtgga
aatactggcagggcgatttctttttttgataccgaatctgataatcatttagcacaacct
ctagttaaagtactgtcagatgctcaacaggatgttcctgcgtggttagaagagattgcc
tttagttcatatgcgcctcccagcttcagtaatagcacaagaggggctgtgtttgcatct
tttgacactaggaagaatttccagggcaagaacacactgaacacagctgggatttcttct
gcacaagctcccaatccagttgatgacgagtcatgggattaa

DBGET integrated database retrieval system