KEGG   Rattus norvegicus (rat): 310344Help
Entry
310344            CDS       T01003                                 

Gene name
Plk4
Definition
(RefSeq) polo-like kinase 4
  KO
K08863  polo-like kinase 4 [EC:2.7.11.21]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    310344 (Plk4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    310344 (Plk4)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    310344 (Plk4)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     310344 (Plk4)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   310344 (Plk4)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    310344 (Plk4)
   Centrosome duplication proteins
    Regulators of centriole replication
     310344 (Plk4)
  Sister chromatid separation proteins
   Polo kinases
    310344 (Plk4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Plk4_PB1 Plk4_PB2 Pkinase_Tyr POLO_box Pkinase_fungal Haspin_kinase Kinase-like DUF4520
Motif
Other DBs
NCBI-GeneID: 310344
NCBI-ProteinID: NP_001101139
RGD: 1305390
Ensembl: ENSRNOG00000011654
UniProt: A0A0G2JZ86
Position
2q25
AA seq 869 aa AA seqDB search
MAACIGERIEDFKVGNLLGKGSFAGLYNYFEDNNYVYLVLEMCHNGEMNRYLKNRMKPRH
FMHQIITGMLYLHSHGILHRDLTLSNILLTRNMNIKIADFGLATQLKMPHEKHYTLCGTP
NYISPEIATRSAHGLESDIWSLGCMFYTLLIGRPPFDTDTVKNTLNKVVLADYEMPAFLS
REAQDLIHQLLRRNPADRLSLSSVLDHPFMSRNPSTKSKDLGTVEDSMDSGHATLSTTIT
ASSGTSLSGSLLDRRRLLVGQPLPNKITVFQKNKNSSDFSSGDGSNFCTQWGNPEQEANN
RGRGRVIEDAEERPHSRYLRRAHSSDRSNPSNQSRAKTYSIERCHSVEMLSKPRRSSLDE
TKHSSNHHCLGKTPFPFADQTPQMEIVQQWFGNLQMNGETSEHNTISPNRDFQDYPDVQD
TLRNTWTDTRASKNSDNSANVHPAKQLSTMKYMTAHHHKPEIMQQELAIHPHSEQNKSRS
MESTLGYRKPTLRSITSPLVAHRLKPIRQKTKKAVVSILDSEEVCVELLKECTSEGHVKE
VLQISSDGTTITVYYPNDGRGFPLADRPPLPTDNISRYSFDSLPEKYWRKYQYASRFIQL
VRSKTPKITYFTRYAKCILMENSPGADFEVWFYDGAKIHKTEDVIHIIEKTGLSYTLKNE
NDFTSLKEEVKIYMDHANEGHRTCLALESVISEEEKRSRGSSFFPIIVGRKPGTTSSPKA
LSPPPVDPGYSKGEQASSSRLSANSAAFPTQTPVLSPSAVTVEGPGQTAATTGTSISSSL
PKSAQLLKSVFVKNVGWATQLTSGAVWVQFNDGSQLVVQAGVSSISYTSPDGQTTRYGEN
EKLPEYIKQKLQCLSSILLMFSNPTPSFQ
NT seq 2610 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtgcatcggagagaggatcgaggactttaaggttggaaatctacttggtaaa
ggatcatttgctggtctctataattactttgaagataacaattacgtatacctggtatta
gaaatgtgccacaacggagaaatgaacaggtacctaaagaacagaatgaagcccaggcac
ttcatgcaccagatcatcacaggaatgctgtatcttcattctcacggcatactacaccgc
gacctcacactctctaacatcttacttacacggaatatgaacataaaaattgctgacttt
ggactagcaacacaattgaaaatgccacatgagaagcattacaccctgtgtggaacccct
aattatatttcaccagaaattgcaactcgaagtgcacatggacttgaatctgatatttgg
tcattgggctgtatgttttatacattacttattggaagaccaccttttgacactgataca
gtcaaaaacacattgaacaaagtagtattggcagattatgaaatgccagcctttttgtca
cgagaggcccaggaccttatccaccaattacttcgtagaaaccctgcagatcggttaagt
ctgtcttctgtgttggaccatccttttatgtcacgaaatccttcaacaaagagtaaagac
ttagggactgtagaggactcaatggatagtgggcatgccacactttccacaacaattaca
gcttcttccggaaccagtttgagtggtagcctacttgacagaagaagacttttggttggt
caaccacttccaaataaaattactgtatttcaaaaaaataaaaattcaagtgacttttct
tcaggagatggaagtaatttttgtactcaatggggaaatccagaacaagaagctaataat
agggggcggggaagagtaattgaagatgcagaagaaaggccacattctcgataccttcgc
agagctcattcctctgatagatccaacccttctaatcagtctcgagcaaaaacatactca
atagagcggtgtcactcagtagaaatgctttcaaagcccagaagatcatcactggatgaa
actaaacacagttccaatcatcattgtctagggaaaactccttttccatttgcagaccag
acacctcagatggagatagtacaacagtggtttgggaatctgcaaatgaatggagaaact
agtgagcacaacaccattagcccaaacagagatttccaggactatcctgatgtgcaggac
acattaagaaatacttggactgacacaagagccagcaagaattccgataattctgctaac
gttcatcctgcaaagcagctgagtaccatgaaatacatgactgcacatcaccataaacct
gagatcatgcagcaagagctggccatacatcctcattctgaacaaaacaagagtagaagt
atggagtcaacattgggttacaggaaacctaccttaagaagcattacctctcctttggtt
gctcacagactaaaaccaatcagacagaaaaccaaaaaggctgtggtgagcatccttgat
tcagaggaggtgtgtgtggagcttctaaaagagtgtacatctgaaggacatgtgaaagaa
gttcttcagatatctagtgatgggactacgatcaccgtttattacccaaatgatggaaga
ggctttcctcttgctgatagaccacccttgcctactgacaacatcagcaggtacagcttt
gacagtttaccagaaaaatactggcggaaatatcagtatgcttccagattcattcagctt
gtaaggtccaaaactcccaaaatcacttactttacaagatatgctaaatgtattttgatg
gaaaattctcctggtgctgattttgaagtttggttttatgatggagccaaaatacataaa
acagaagatgtaattcacataattgaaaaaactgggttatcttacactttaaaaaatgag
aatgactttaccagcttgaaagaggaagtaaaaatctatatggaccatgccaatgagggt
caccgtacttgcttggcactggaatctgtaatctctgaagaggaaaaaagaagcaggggc
tcttcattcttcccaataattgtaggaagaaaacctggtactactagttcacctaaagcc
ttatcaccacctcctgtggacccaggctactcaaagggagagcaagcatcatcaagcaga
ttgagcgcgaatagtgcggctttcccaacacagacaccagtactcagtccttctgctgtg
acagtggaaggacctggccaaacagcagctactacaggaacaagcatctcttcaagtctt
cctaaatcagcacagcttttgaaatctgtttttgtgaaaaatgttggttgggctacacag
ctaactagtggagctgtgtgggttcagtttaatgatgggtcacagttggttgtccaggca
ggagtatcttccatcagttatacatcaccagacggtcagacaactaggtatggagaaaat
gaaaaattgcctgaatacatcaaacagaaattgcaatgtctttcttccatccttctgatg
ttttctaatccaactcctagttttcagtaa

DBGET integrated database retrieval system