KEGG   Rattus norvegicus (rat): 310363
Entry
310363            CDS       T01003                                 

Gene name
Fbxo4
Definition
(RefSeq) F-box protein 4
  KO
K10291  F-box protein 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    310363 (Fbxo4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    310363 (Fbxo4)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     310363 (Fbxo4)
SSDB
Motif
Pfam: F-box-like F-box PRANC Arf
Other DBs
NCBI-GeneID: 310363
NCBI-ProteinID: NP_001101142
RGD: 1307580
Ensembl: ENSRNOG00000015622
UniProt: D3ZIH4
Position
2q16
AA seq 431 aa
MSHSGPPRPGAAPSRPAWLVPAGRAETEAERLGNRCARPCLAEPAAMAGSEPRGAGSPPP
ASDWGRLEAAILSGWRTFWNSVGKERATRTASRKEEAEETSALTRLPIDVQLYILSFLSP
HDLCQLGSTDHYWNETVRDPILWRYFLFRDLPSWSSVDWKSLPDLEILKKPISEVTDSTC
FDYMEVYKMCCPYTRRALKASRPMYGAVTSFLHSLIIQNEPRFAMFGPGLEELNTSLVLS
LMSSEDLCPTAGLPHRQIDGIGSGVSFQLSNQHKFNILILYSTTRKERDRAREEHTSTVN
KMFSLQSEGDEQQGSRYSVIPQIQKVCEVVDGFIYVANAEAHRRHEWQDEFSRIMAMTDP
AFGSSGRPMLVLSCISQADVKRMPCFYLAHELRLSLLNHPWMVQDTEAETLTGFLNGIEW
ILEEVESKHAK
NT seq 1296 nt   +upstreamnt  +downstreamnt
atgagtcattccgggccacctcggcctggagccgcgcccagcagaccagcctggctcgtc
ccagcggggcgggcggagacggaggccgagcggctgggaaaccggtgcgcccggccgtgt
ctcgcggagcccgcagccatggctggaagcgagccccgcggagccggctccccgccgccc
gccagcgactggggccgcctggaggctgctatcctgagcggctggaggaccttctggaat
tcggtgggcaaggagcgggcgacgcggacggcctcccggaaggaggaggcggaggagacg
agcgcgctgacgcggctgccgattgatgtgcagctgtatatcttgtcatttctttcaccc
catgacctgtgccagttgggaagtacagatcactattggaatgaaactgtaagagaccca
attctctggagatactttctgtttcgagatctcccttcttggtcctctgttgattggaag
tcacttccggatctagagatattaaaaaagcccatatctgaggtcaccgacagcacatgt
tttgattacatggaggtttataaaatgtgctgtccatatacgagaagagccttgaaagcc
agccgtcctatgtatggagcggttacctctttcttacactcactgatcattcagaatgaa
ccccggtttgctatgtttggaccaggtttggaagaactgaacacatctttggtgttgagt
ttgatgtcttctgaggatctttgcccaactgctggtttacctcatagacagattgacggt
attggatctggagtcagtttccagttgagcaatcaacacaaattcaacatcctgatactg
tactcaactaccagaaaggaaagagacagagcgagggaggagcacacaagcacggttaac
aagatgttcagcctacagagcgagggagacgagcaacaggggagccgctacagcgttatc
ccacagattcagaaagtgtgtgaggttgtagatgggtttatctacgtggcaaatgctgaa
gctcatagacgtcatgaatggcaagatgaattttctcgtattatggccatgacagatcca
gcttttggatcttcaggaagaccaatgctggttttatcttgtatttctcaagcagatgta
aaaagaatgccttgtttttatttagctcatgaacttcgtctcagtcttctgaaccaccca
tggatggtccaggatacagaggctgagactctgactggtttcttgaatggcattgagtgg
attcttgaagaagtagaatctaagcatgcgaaatga

DBGET integrated database retrieval system