KEGG   Rattus norvegicus (rat): 310652Help
Entry
310652            CDS       T01003                                 

Gene name
Tdrkh, RGD1311196
Definition
(RefSeq) tudor and KH domain containing
  KO
K18406  tudor domain-containing protein 2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    310652 (Tdrkh)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Gene silencing
   piRNA pathway
    310652 (Tdrkh)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: KH_1 TUDOR KH_4 KH_2
Motif
Other DBs
NCBI-GeneID: 310652
NCBI-ProteinID: NP_001014060
RGD: 1311196
Ensembl: ENSRNOG00000020860
UniProt: G3V8T7
Position
2q34
AA seq 560 aa AA seqDB search
MSTERTSWTNLSTIQKIALGLGIPASATVAYILYRRYRESREERLTFVGEDDIEIEMRVP
QEAVKLIIGRQGANIKQLRKQTGARIDVDTEDVGDERVLLISGFPVQVCKAKAAIHQILT
ENTPVFEQLSVPQRSVGRIIGRGGETIRSICKASGAKITCDKESEGTLLLSRLIKISGTQ
KEVAAAKHLILEKVSEDEELRKRIAHSAETRVPRKQPISVRREEVTEPGGAGEAALWKNT
NSSMGPAAPLEVPLRKGGGDMVVVGPKEGSWEKPNDDSFQNSGAQSSPETSMFEIPSPDF
SFHADEYLEVYVSASEHPNHFWIQIIGSRSLQLDKLVSEMTQHYENSLPEDLTVHVGDIV
AAPLSTNGSWYRARVLGTLENGNLDLYFVDFGDNGDCPLKDLRALRSDFLSLPFQAIECS
LARIAPSGEEWEEEALDEFDRLTHCADWKPLVAKISSYVQTGISTWPKVYLYDTSNGKKL
DIGLELVRKGYAVELPEDMEENRTVPDMLKDMATETDDSLASILTETKKSPEEIPHTLSC
LSLSEAASMSGDDNLEDDLF
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccgaacgaacttcatggacaaacctgtccactattcagaaaatagccctgggc
ctgggaattccagcaagtgcgacagttgcctacatcctgtatcgtcgatacagggaaagt
agagaagagagattgacatttgttggagaagatgacattgaaatagagatgcgagttccc
caagaagctgtgaagctcatcattggtcgacaaggagccaatattaaacagctgcggaag
cagacaggtgctcggattgatgtggacacggaggatgtaggcgatgagcgggtgctgctg
atcagtggttttcctgttcaggtgtgcaaggccaaagcagcaatccatcaaatcctgaca
gagaacaccccagtgtttgagcaactctctgtcccccagagatctgtgggcagaatcata
gggagaggcggtgagaccattcgttctatctgtaaggcttctggagccaaaatcacttgc
gacaaggaatcagagggaacattactactctcacgacttataaaaatctcaggaacacag
aaggaagtggctgcagccaagcatctgatactggagaaagtttcagaagatgaggaactt
cggaagagaattgcccattctgcagaaaccagagtcccccgaaagcagccaatcagcgtg
agaagagaggaagtgacagagcctggtggagctggagaagcagctttatggaaaaataca
aattctagcatgggaccagctgcacccctggaagttcctctccgcaaaggaggtggtgat
atggttgttgtaggaccaaaagaaggttcctgggagaaacctaatgatgacagctttcag
aattctggtgcccagagcagtccagagacgtctatgtttgaaattcccagtcctgacttc
agtttccatgctgatgagtacctagaagtctacgtttctgcttctgaacaccctaaccac
ttctggatccagatcattggttcccgcagcctacagttggataaacttgtcagtgagatg
acccagcactatgagaatagtctgcctgaagacctgactgtgcatgtaggagacattgta
gcagcacccttatctacaaatggttcctggtatcgagcccgggttctgggaaccttggaa
aatggaaacttggacctctactttgttgactttggagataatggagattgcccactaaag
gatctcagggctctcaggagtgactttctaagtctcccatttcaagcaatagaatgcagt
ctggcacggattgccccctcaggtgaagagtgggaagaggaagctctagatgagtttgac
agactcactcactgtgctgactggaagcccctggtggccaagatttctagctatgtccag
actggaatttcaacttggccaaaggtctatttatatgataccagcaatggaaagaaactt
gatattgggctagaattagttcgtaaaggatatgcagttgaacttcctgaagacatggaa
gaaaatagaactgtcccagatatgttgaaggacatggccacagaaacagatgattctctt
gcaagcatactcactgagacaaaaaagagccctgaagagataccacataccctgtcctgc
ctcagcttatcagaagctgcctctatgtctggtgatgataaccttgaagatgacttattc
tga

DBGET integrated database retrieval system