KEGG   Rattus norvegicus (rat): 311352
Entry
311352            CDS       T01003                                 

Gene name
Adal
Definition
(RefSeq) adenosine deaminase-like
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: A_deaminase Amidohydro_1
Other DBs
NCBI-GeneID: 311352
NCBI-ProteinID: NP_001014069
RGD: 1359517
Ensembl: ENSRNOG00000012166
UniProt: Q5FVI8
Position
3q35
AA seq 217 aa
MAIDRKGGPTVAKETVKLAKEFFLSAEDTVLGLDLSGDPTIGQAKDFLEPLLEAKKAGLK
LALHLAEIPNKEKETQMLLDLLPDRIGHGTFLNTPEAGSVDQVNFVRQHRIPLELCLTSN
IKSQTVPSYDQHHFGFWYSVAHPSVICTDDKGVFATSLSQEYQLAAETFNLTPSQVWDLS
YESINYIFASNNTRSELRKRWTHLKQKVLGCNEVNYF
NT seq 654 nt   +upstreamnt  +downstreamnt
atggcaattgacagaaaaggtggcccgacagtagccaaggagactgtcaaacttgctaaa
gagttcttcctctctgctgaggatacagttcttggccttgacctcagtggagatccaact
atcggacaagcaaaagacttcttggagcctcttttagaagctaaaaaagcaggcctgaag
ttggcgttgcatcttgcagagattccaaataaggaaaaagaaacacagatgttgctggat
ctgcttcctgacagaattgggcatggaacattcctcaacacccccgaggcagggtcagtg
gatcaggtgaacttcgtgaggcaacaccggatacctcttgaactttgtttgacctcaaac
atcaaaagccagacagttccttcttatgaccagcatcactttggattctggtatagcgtt
gctcatccttctgtgatctgtaccgatgataaaggtgtttttgcaacaagcctttctcaa
gaatatcaactggcagcagaaacatttaatctgaccccatcgcaggtgtgggatctgtct
tatgaatccatcaactacatcttcgcttctaacaacaccagatctgaactgagaaaaagg
tggactcacctgaaacagaaagtgttaggctgtaacgaggtgaactacttttga

DBGET integrated database retrieval system