KEGG   Rattus norvegicus (rat): 311647
Entry
311647            CDS       T01003                                 

Gene name
Prex1
Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein
  KO
K12365  phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchanger 1 protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04062  Chemokine signaling pathway
rno05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    311647 (Prex1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    311647 (Prex1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    311647 (Prex1)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   311647 (Prex1)
SSDB
Motif
Pfam: RhoGEF DEP PDZ_6 PDZ PH PH_10
Other DBs
NCBI-GeneID: 311647
NCBI-ProteinID: NP_001129190
RGD: 1306534
Ensembl: ENSRNOG00000006952
Position
3
AA seq 1646 aa
MEAPGSGSGDGGGDPGGDGAHPDARGPSSGPCAAARDSERQLRLRLCVLNEILATERDYV
GTLRFLQSAFLQRIRQNVADSVDKGLTEENVKILFSNIEDILEVHKDFLAALEYCLHPEP
QSQHELGNVFLKFKDKFCVYEEYCSNHEKALRLLVELNKVPAARAFLLNCMLLGGRKTTD
IPLEGYLLSPIQRICKYPLLLKELSKRTPGKHPDHSAVQSALQAMKTVCSNINETKRQME
KLEALEQLQSHIEGWEGSNLTDICTQLLLQGTLLKISAGNIQERAFFLFDNLLVYCKRKS
RVTGSKKSTKRTKSINGSLYIFRGRINTEVMEVENVEDGTADYHSNGYTVTNGWKIHNTA
KNKWFVCMAKTAEEKQKWLDALIREREQRESLKLGMERDAYVMIAEKGEKLYHMMMSKKV
NLIKDRRRKLSTVPKCFLGNEFVAWLLEIGEISKTEEGVNLGQALLENGIIHHVSDKHQF
KNEQVMYRFRYDDGTYKARSELEDIMSKGVRLYCRLHSLYAPVIKDRDYHLKTYKSVVPG
SKLVDWLLAQGDCQTREEAVALGVGLCNNGFMHHVLEKSEFKDESQYFRFHADEEMEGTS
SKNKQLRNDFKLVENILAKRLLIPPQEDDYGFDLEEKNKAVVVKSVQRGSLAEMAGLQAG
RKIYSINEDLVFLRPFSEVETILNQSFCSRRPLRLLVATKAKETIKIPDHPEALSFQIRG
TAPPCVFAVGRGSEAVAAGLCAGQCILKVNGNSVANDGALEVLEHFQAFRSRREEALGLY
QWVYHSHEDAQQARASQGAPDEDPQEDDSVLPLLSLGPQLSLHEDSAVVSLTLDNVHLEH
GVVYEYVSTAGAKCHVLEKIVEPRGCFRLAAKILEAFAEDDSLFVQNCGRLMAMGSAIIT
MSHYEFHNICDTKLESIGQRIACYQEFAAQLKSRVSPPFKQAPLEDHPLCGLDFCPTNCH
INFMEVSYPKTTPSVGRSFSIRFGRKPSLIGLDPEQGHLNPMAYTQHCITTMAAPSWKCA
PAVDGDSQSQGLIDSIFVSASGALSQQERGLSFLLKQEDREIQDAYLQLFTKLDVALKEM
KQYVTQINRLLSTITEPTSAAPCDPPLVEETSSSPPASEESEVDRTDHGGIKKVCFKVSE
DEQEDSGHDTMSYRDSYSECNSNRDSVLSYTSVRSNSSYLGSDETGSGDELPCDIRIPSD
KQDKLHGCLEHLFNQVDSIHALLKGPVMSRAFEETRHFPMEHSWQEFKQKEECTVRGRNL
IQISIQEDPWNLPSSIRTLVDNIQRYVEDGKNQLLLALLKCTDTELQLRRDAVFCQALVA
AVCTFSEQLLAALDYRYNNNGEYEESSRDASRKWLEQVAATGVLLHWQSLLAPATVKEER
TMLEDIWVTLSELDNVTFSFKQLDENSVANTNVFYHIEGSRQALKVVFYLDGFHFSRLPS
RLEGGASLRLHTVLFTKALENVEGPSPPGSQAAEDLQQEINAQSLEKVQQYYRRLRAFYL
ERSNLPTDATTTAVKIDQLIRPINALDELYRLMKSFVHPKAGAGGSLGAGLVPVSSELCY
RLGACQITMCGTGMQRSTLSVSLEQAAILARSHGLLPKCVMQATDIMRKQGPRVEILAKN
LRIKDPMPQGAPRLYRLCQPPVDGDL
NT seq 4941 nt   +upstreamnt  +downstreamnt
atggaggcgcccggcagcggtagtggcgatggcggcggggacccaggcggggacggtgcg
catcccgatgctcgcggtcccagctccgggccatgcgcggccgcccgcgactcggagcgc
cagctgcgcctccgtctgtgcgtactcaacgagatcctggccaccgagcgcgactacgtg
ggcaccttgcgtttcctgcagtcggcgttcctacagcggatccggcagaatgtggccgac
tctgtggacaagggcctcacggaagagaatgtcaagatcctcttctccaacattgaggac
atcttggaggtccataaggattttttggctgccctggaatactgcctacatccggagccc
cagtctcagcacgaacttgggaatgttttcttgaaatttaaggacaagttctgtgtgtat
gaggagtactgcagtaaccacgagaaggccctgcgtctgttggtggagctcaacaaggtc
cctgccgctcgcgccttcctcctgaactgcatgcttctgggaggccggaagaccacggac
atccctctggagggctacctgctgtcccccatccagaggatctgcaagtacccactcctg
ctcaaggagttatctaagaggaccccgggcaaacaccctgaccattccgcggtacagagc
gccctgcaagccatgaagaccgtctgctccaacatcaatgagaccaagaggcagatggag
aagctggaggccctggagcagctgcagtctcacatcgaaggctgggagggctcgaacctc
acagacatctgcacccagcttctccttcagggcactctgctgaagatctctgcaggcaac
atccaagagagagccttcttcctcttcgacaacttgctcgtctactgcaagcggaaatct
agggtcactgggagcaagaaatctaccaagaggaccaagtccatcaacggctccctgtac
atcttcaggggtcggatcaacactgaggtcatggaagtggagaatgtggaagacgggaca
gccgattaccacagcaatggctacaccgtcaccaatggctggaagatccacaatacagcc
aaaaacaagtggtttgtgtgtatggccaagacagcagaggagaagcagaagtggctggac
gccctgatccgagagcgggagcagcgagagagcctgaagctgggcatggagcgcgacgca
tacgtcatgattgcggagaagggggagaagctgtatcacatgatgatgagcaagaaggtg
aacttgatcaaggaccgccgacggaagctgagcaccgtccccaagtgcttccttggcaat
gagtttgtcgcctggctcctggaaattggtgagatcagcaagacagaagaaggggtcaac
ttgggccaggccctgttggagaatggcatcatccaccacgtctccgacaagcatcagttc
aagaacgagcaggtgatgtatcgcttccgctacgacgatggcacctacaaagcccgcagc
gagctggaggacatcatgtccaagggcgtgagactctattgccggcttcacagcctgtac
gcccccgtgatcaaggaccgtgattaccacctgaagacctacaagtccgtggtccccggg
agcaagctggtcgactggctcctggcacagggggactgccagacacgggaggaggcggtg
gcgctgggtgtgggcctgtgcaacaacggtttcatgcaccatgttctggagaagagcgaa
ttcaaggacgagtctcagtacttccgcttccatgcggacgaggagatggaagggaccagc
agcaagaacaaacagcttcgcaacgacttcaagctagtggagaacatcctggccaagcgg
ctgctgatcccgccgcaggaggatgactatggcttcgatcttgaggagaagaacaaggca
gtggtggtgaagtccgtgcagaggggttcgctggctgagatggctggcctgcaggcgggg
aggaagatttactccatcaacgaggacctggtgttcctacggcccttctctgaggtggag
accatccttaaccagtccttctgctcccgccgcccgctgcgcctcctggtggccaccaag
gccaaagagaccatcaaaatccctgaccacccagaggccctgtccttccagattcgagga
acagccccgccgtgtgtctttgccgtgggcagaggttctgaggctgtggctgccgggctc
tgcgcaggccaatgcatcctgaaagtcaacggcaacagcgtggcaaatgatggcgccctt
gaagttctggagcacttccaggctttccgcagccgcagggaggaggccctgggcctttac
cagtgggtctaccacagccacgaggacgcccagcaggcgagagccagccagggtgccccg
gatgaggacccccaggaggatgactcagtcctgcccctgctgtccctgggtccccagctg
agcctgcacgaggacagcgctgtggtcagcctgacgctggacaatgttcacttggagcac
ggtgtggtttatgaatacgtgagcacagcaggagccaagtgtcacgtgctggaaaagatc
gtggagccccgaggctgtttccgcctggctgccaagatccttgaggcctttgccgaggac
gacagcctcttcgtgcagaactgtgggcggctcatggccatgggcagcgctatcatcacc
atgtcccactacgagttccacaacatctgtgacaccaagctggagagcattggccagaga
atcgcctgctaccaggagtttgcagcccagctgaagagcagggtcagcccccccttcaag
caggcacccctggaggaccacccgctgtgtggcctggacttctgccctaccaactgccac
atcaacttcatggaggtgtcctaccccaagaccaccccttcagtgggcaggtccttcagc
atccgctttgggcgcaaaccctccctcatcggccttgacccagaacaaggccacctgaac
cccatggcttacacccagcactgtatcaccaccatggctgccccgtcctggaagtgcgcg
cctgctgtagatggggactctcaaagccaaggtctcattgacagtatcttcgtgtcagcc
agtggtgccctgagccagcaagaacggggcctgagctttctgctcaagcaggaggaccgg
gagatccaggacgcgtatctgcagctcttcactaagctggatgtggccctcaaggagatg
aagcagtatgtcacccagatcaacaggctgctgtcaaccatcacagagcccacgtcagct
gcaccctgtgacccacccttggtggaggagacctcatcttccccaccggccagtgaagag
agcgaagtggacaggactgaccatggcggcatcaagaaggtgtgcttcaaggtgtcagag
gacgagcaggaagactcgggccacgacaccatgagctaccgagactcctatagtgagtgt
aacagcaatcgtgactctgtcctgtcctacaccagcgtgagaagcaacagttcgtacctg
ggcagtgatgagacaggctcaggggatgagctgccctgtgacatacgcatcccatccgac
aagcaggacaaacttcacggctgcctggaacatctctttaaccaggtggattccatccat
gccctgctcaaggggcctgtgatgagcagggcgtttgaggagaccaggcatttccccatg
gagcacagctggcaagagttcaaacagaaagaagaatgcacagtccgaggccggaacttg
atccagatcagcatccaggaggacccttggaacctacccagctccatcaggaccctggta
gacaacatccagcgatatgtggaagatgggaagaaccagctgcttctggccctgctgaaa
tgcacagacacggagctgcagctgcgcagggatgctgtcttctgtcaggccctggtggcc
gccgtgtgcaccttctcggagcagctgctggccgccctcgactaccgctacaacaacaac
ggcgagtatgaagagagcagcagagacgccagccgcaagtggctggagcaggtggcagcc
accggtgtcctgctgcactggcagtccctgctggcaccagccaccgtgaaagaggaacgg
accatgctggaggacatctgggtgacactgtcggagctggacaatgtcaccttctccttt
aagcagctggatgagaattctgtggccaacaccaacgtcttctaccacattgagggcagc
aggcaggcactgaaggtagtcttctacctcgatggcttccacttctccaggctgccctct
cgcctggagggtggggccagcctcaggctgcacaccgtgctattcacaaaagctctggag
aatgtggaagggccgtcgcccccaggaagccaggctgcagaagatctgcagcaggagatc
aatgcgcagtccctggagaaggttcagcagtactatagaaggctcagggccttctacctg
gagcggtccaacctccccacagatgctaccaccacagctgtgaagatcgaccagctgatc
cgtcccatcaacgccctggacgagctctaccgcctcatgaagtccttcgtgcacccgaaa
gctggtgctggtgggagcctaggtgccggcctcgtccccgtctcctctgagctctgctac
cgtctgggggcgtgtcagatcaccatgtgtggcaccggcatgcagcggagcaccctgagc
gtgtccttggaacaagcagccatcttggctcggagccacgggctgctgcccaagtgtgtt
atgcaggccacagacatcatgcgcaagcagggcccccgagtggagatcctggcaaaaaac
ctccgcatcaaagacccaatgccccaaggtgcaccacgcctctaccgcctctgccagcct
ccggtggatggagacctctga

DBGET integrated database retrieval system